Recombinant Helicobacter pylori Cbb3-type cytochrome c oxidase subunit CcoP (ccoP)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Helicobacter pylori Cbb3-type Cytochrome c Oxidase Subunit CcoP

Recombinant Helicobacter pylori Cbb3-type cytochrome c oxidase subunit CcoP is a protein produced through recombinant DNA technology, typically in systems like Escherichia coli or yeast. This protein is part of the Cbb3-type cytochrome c oxidase complex, which plays a crucial role in the bacterial respiratory chain of Helicobacter pylori, a bacterium known for causing gastric ulcers and being associated with gastric cancer.

Structure and Function

Characteristics of Recombinant Helicobacter pylori CcoPDescription
SourceProduced in E. coli or other expression systems .
Expression RegionTypically includes amino acids 1-292 .
FunctionEssential for bacterial respiration under microaerobic conditions.
ApplicationsUsed in research and potentially in vaccine development .

Production and Applications

Recombinant CcoP is produced using various expression systems, including E. coli, yeast, or mammalian cells. This versatility allows for different applications, such as research into bacterial respiration mechanisms and potential use in vaccine development against Helicobacter pylori infections.

Production Systems:

  • E. coli: Commonly used for its efficiency and cost-effectiveness .

  • Yeast: Offers advantages in terms of post-translational modifications .

  • Mammalian Cells: Can provide more complex modifications but is less common for this protein .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ccoP; HP_0147; Cbb3-type cytochrome c oxidase subunit CcoP; Cbb3-Cox subunit CcoP; C-type cytochrome CcoP; Cyt c(P; Cytochrome c oxidase subunit III
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-286
Protein Length
full length protein
Species
Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)
Target Names
ccoP
Target Protein Sequence
MDFLNDHINVFGLIAALVILVLTIYESSSLIKEMRDSKSQGELVENGHLIDGIGEFANNV PVGWIASFMCTIVWAFWYFFFGYPLNSFSQIGQYNEEVKAHNQKFEAKWKHLGQKELVDM GQGIFLVHCSQCHGITAEGLHGSAQNLVRWGKEEGIMDTIKHGSKGMDYLAGEMPAMELD EKDAKAIASYVMAELSSVKKTKNPQLIDKGKELFESMGCTGCHGNDGKGLQENQVFAADL TAYGTENFLRNILTHGKKGNIGHMPSFKYKNFSDLQVKALLNLSNR
Uniprot No.

Target Background

Function
Recombinant Helicobacter pylori Cbb3-type cytochrome c oxidase subunit CcoP (ccoP) is a c-type cytochrome and a component of the cbb3-type cytochrome c oxidase complex. The CcoP subunit facilitates electron transfer from donor cytochrome c via its heme groups to the CcoO subunit. Electrons are subsequently transferred to the catalytic binuclear center of the CcoN subunit, where oxygen reduction occurs. The complex also functions as a proton pump.
Database Links
Protein Families
CcoP / FixP family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the structural composition of H. pylori cbb3-type cytochrome c oxidase?

Helicobacter pylori cbb3-type cytochrome c oxidase belongs to the heme copper oxidase superfamily. Similar to the well-characterized homolog in Rhodobacter capsulatus, it consists of four primary subunits: CcoN, CcoO, CcoP, and CcoQ. CcoN contains the binuclear center where oxygen reduction occurs, consisting of a high-spin heme and copper atom (CuB). CcoP and CcoO are membrane-bound c-type cytochromes that function as electron channels from donor cytochromes to the binuclear center. CcoQ is a non-cofactor-containing subunit with a single-spanning membrane topology (Nout-Cin orientation) that plays a critical role in stabilizing the complex .

The CcoP subunit specifically contains c-type heme groups and is essential for the assembly of the functional oxidase complex. Unlike aa3-type cytochrome oxidases, the cbb3-type has a distinct subunit arrangement that contributes to its high oxygen affinity, which is particularly important for H. pylori survival in the microaerobic environment of the gastric mucosa.

What expression systems are most effective for producing recombinant H. pylori CcoP?

For optimal expression, consider the following protocol guidelines:

  • Clone the ccoP gene into a vector with an inducible promoter (e.g., pET series)

  • Transform into E. coli BL21(DE3) harboring pEC86 (encoding the ccm genes)

  • Culture at lower temperatures (16-20°C) post-induction

  • Include δ-aminolevulinic acid (50-100 μM) in the growth medium as a heme precursor

  • Use mild induction conditions (0.1-0.5 mM IPTG) to prevent formation of inclusion bodies

This approach minimizes protein misfolding while maximizing functional incorporation of heme groups essential for cytochrome c functionality.

How can researchers verify the successful expression and folding of recombinant CcoP?

Verification of properly expressed and folded recombinant CcoP requires multiple analytical approaches:

  • Spectroscopic Analysis: UV-visible spectroscopy to confirm characteristic absorbance peaks of c-type cytochromes (α-band at ~550 nm in the reduced state)

  • Immunological Detection: Western blotting using antibodies against CcoP or attached epitope tags

  • Heme Staining: TMBZ (3,3',5,5'-tetramethylbenzidine) staining of SDS-PAGE gels to verify covalent heme attachment

  • Mass Spectrometry: LC-MS/MS analysis to confirm heme attachment to the CXXCH motifs

  • Functional Assays: Oxygen consumption assays when the subunit is reconstituted with other components

It's worth noting that properly folded c-type cytochromes show distinct migration patterns on SDS-PAGE compared to their apo-forms, providing a simple initial screening method. Additionally, successfully expressed CcoP should bind to human antiserum, similar to what has been observed with other recombinant H. pylori antigens .

What purification strategies yield the highest purity and activity of recombinant CcoP?

Purification of membrane-associated cytochromes like CcoP requires specialized approaches:

  • Membrane Fraction Isolation:

    • Cell disruption by sonication or French press

    • Differential centrifugation to isolate membrane fractions (30,000-100,000 × g)

    • Solubilization with mild detergents (0.5-2% n-dodecyl-β-D-maltoside)

  • Chromatographic Purification:

    • Immobilized metal affinity chromatography (IMAC) using His-tagged constructs

    • Ion exchange chromatography (particularly effective for charged cytochromes)

    • Size exclusion chromatography as a final polishing step

  • Detergent Considerations:

    • Maintain detergent above critical micelle concentration throughout purification

    • Consider detergent exchange during purification to optimize stability and activity

  • Stability Enhancement:

    • Include glycerol (10-20%) in all buffers

    • Maintain reducing conditions with 1-5 mM DTT or 2-mercaptoethanol

    • Consider adding specific lipids to stabilize the protein-detergent complex

Combining these approaches typically yields protein with >90% purity and preserved heme content, essential for functional studies .

How does the CcoP subunit interact with other components of the cbb3-type oxidase complex?

The interaction between CcoP and other subunits of the cbb3-type oxidase is complex and essential for proper enzyme function. Drawing from studies on homologous systems like R. capsulatus:

  • CcoP-CcoQ Interaction:
    CcoQ plays a critical role in stabilizing CcoP's incorporation into the functional complex. Chemical cross-linking experiments have confirmed direct CcoP-CcoQ interactions. In the absence of CcoQ, CcoP fails to stably associate with the CcoNO core complex, resulting in significantly reduced oxidase activity regardless of growth conditions .

  • CcoP-CcoN Interface:
    CcoP interacts with the catalytic CcoN subunit to facilitate electron transfer to the binuclear center. This interaction involves specific transmembrane helices and periplasmic domains.

  • Electron Transfer Chain:
    CcoP accepts electrons from periplasmic cytochrome c donors and transfers them via its multiple heme centers to CcoO and ultimately to the CcoN catalytic site.

The CcoQ-CcoP interaction is particularly critical, as it directly impacts the formation of the active 230-kDa cbb3-type oxidase complex. Blue native polyacrylamide gel electrophoresis analyses have revealed that absence of CcoQ specifically impairs the stable recruitment of CcoP into the complex .

What experimental approaches can address the impact of CcoP mutations on H. pylori colonization?

Investigating the relationship between CcoP mutations and H. pylori colonization capabilities requires multi-faceted experimental approaches:

  • Site-Directed Mutagenesis Strategy:

    • Target conserved heme-binding motifs (CXXCH)

    • Modify predicted interaction surfaces with CcoQ

    • Create chimeric proteins with related bacterial species

  • In Vitro Functional Characterization:

    • Oxygen consumption assays with reconstituted enzyme complexes

    • Electron transfer kinetics using stopped-flow spectroscopy

    • Proton pumping assays in reconstituted proteoliposomes

  • Animal Models:

    • Mouse infection models using H. pylori strains with wild-type vs. mutant ccoP

    • Quantitative assessment of colonization by culturing stomach tissue

    • Competitive index determination when co-infecting with wild-type and mutant strains

  • Human Volunteer Studies (with ethical considerations):

    • Using the established challenge model described by Graham et al. for evaluating attenuated strains with ccoP modifications

    • Careful monitoring and eradication treatment post-experiment

This approach permits correlation of biochemical properties with colonization phenotypes, essential for understanding the role of CcoP in H. pylori pathogenesis. The human challenge model should be used cautiously, with proper strain selection and ethical oversight, as demonstrated in previous H. pylori research .

How can researchers quantitatively assess the impact of environmental conditions on CcoP expression and activity?

The expression and activity of CcoP in H. pylori is likely influenced by microaerobic conditions and other environmental factors encountered in the gastric niche. To quantitatively assess these relationships:

  • Controlled Growth Conditions:

    • Variable oxygen tension (0.5-5% O₂) using specialized incubators

    • pH gradient studies (pH 4.5-7.0) to mimic gastric microenvironments

    • Varying nutrient availability simulating gastric mucosa

  • Quantitative Expression Analysis:

    • RT-qPCR for transcript level measurement

    • Targeted proteomics using selected reaction monitoring (SRM)

    • Western blot with densitometry for protein quantification

  • Activity Measurements:

    • Spectrophotometric assays for cytochrome c oxidation rates

    • Oxygen consumption measurements using Clark-type electrodes

    • Membrane potential determinations using potential-sensitive dyes

  • Data Integration:

    • Time-course experiments to capture dynamic responses

    • Mathematical modeling of expression-activity relationships

    • Multi-parameter analysis for identifying critical environmental thresholds

These methodologies provide comprehensive datasets for understanding how H. pylori modulates its respiratory chain components in response to environmental challenges, offering insights into adaptation mechanisms during infection.

What are the potential applications of recombinant CcoP in vaccine development against H. pylori?

While CcoP has not been extensively studied as a vaccine antigen compared to other H. pylori proteins, several methodological approaches could evaluate its potential:

  • Antigenicity and Immunogenicity Assessment:

    • Binding of recombinant CcoP to human sera from H. pylori-infected patients

    • Immunization studies in mice measuring humoral and cellular responses

    • Cytokine profile characterization (Th1/Th2/Th17 balance)

  • Adjuvant Formulation Optimization:

    • Testing CpG adjuvants similar to those effective with CagA

    • Combining with mucosal adjuvants for targeted immune responses

    • Evaluating lipopolysaccharide co-delivery systems

  • Protection Evaluation Strategies:

    • Challenge studies in immunized animal models

    • Quantification of bacterial load reduction

    • Assessment of inflammatory markers and tissue pathology

  • Combination Antigen Approaches:

    • Co-immunization with established protective antigens (urease, CagA, VacA, HpNAP)

    • Epitope mapping to create chimeric constructs

    • Evaluation of cross-protection against diverse H. pylori strains

The development of an effective H. pylori vaccine remains challenging, with no commercially available options despite decades of research. Studies have shown that combining antigens with appropriate adjuvants can produce strong Th1-biased immune responses, crucial for protection against H. pylori. Similar approaches could be applied to evaluate CcoP's potential contribution to vaccine development .

How can advanced structural biology techniques be applied to characterize CcoP-CcoQ interactions in H. pylori?

Understanding the structural basis of CcoP-CcoQ interactions requires sophisticated structural biology approaches:

  • Cryo-EM Analysis:

    • Sample preparation of purified cbb3-type oxidase complexes

    • High-resolution imaging (2-3 Å) of intact complexes

    • 3D reconstruction to identify interaction interfaces

  • Cross-linking Mass Spectrometry (XL-MS):

    • Application of MS-cleavable cross-linkers to intact complexes

    • Identification of spatial relationships between subunits

    • Mapping of interaction domains with residue-level resolution

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

    • Probing conformational dynamics and solvent accessibility

    • Identifying protected regions indicating protein-protein interfaces

    • Monitoring structural changes upon complex formation

  • Integrated Computational Modeling:

    • Homology modeling based on related bacterial cytochrome oxidases

    • Molecular dynamics simulations of subunit interactions

    • Refinement using experimental constraints from cross-linking

  • Functional Validation of Structural Insights:

    • Site-directed mutagenesis of predicted interface residues

    • In vitro assembly assays with purified components

    • Activity measurements of reconstituted complexes

These techniques would provide unprecedented insights into how CcoQ stabilizes CcoP integration into the functional oxidase complex, building upon the findings from R. capsulatus studies where CcoQ has been shown to be crucial for optimal cbb3-type oxidase activity .

What are the relative advantages of different experimental systems for studying H. pylori CcoP?

The following table compares key experimental systems for investigating recombinant H. pylori CcoP:

Experimental SystemAdvantagesLimitationsBest Applications
E. coli expression- Well-established protocols
- High yield potential
- Compatible with Ccm co-expression
- May lack H. pylori-specific chaperones
- Different membrane composition
- Initial protein characterization
- Structural studies
- Antibody production
H. pylori native expression- Authentic post-translational modifications
- Natural interaction partners present
- Native membrane environment
- Lower yield
- More challenging cultivation
- Limited genetic tools
- In situ interaction studies
- Physiological regulation analysis
- Validation of E. coli findings
Cell-free expression- Rapid production
- Avoids toxicity issues
- Allows unnatural amino acid incorporation
- Limited post-translational modifications
- Lower yield for membrane proteins
- Higher cost
- Rapid mutant screening
- Toxic variant production
- Specialized labeling studies
Reconstitution in liposomes- Defined lipid environment
- Control over protein components
- Suitable for biophysical studies
- Artificial system
- Complex preparation
- May miss cellular factors
- Electron transfer kinetics
- Proton pumping assays
- Drug interaction studies
Animal models- Physiological context
- Integration with immune system
- Colonization assessment
- Species differences
- Complex variables
- Ethical considerations
- Vaccine development
- Virulence studies
- Host interaction analysis

The selection of an appropriate experimental system depends on the specific research questions being addressed. For detailed biochemical characterization, E. coli expression followed by reconstitution in liposomes often provides the most controlled environment. For understanding physiological relevance, studies in the native H. pylori or animal models become essential .

How do analytical techniques for studying cbb3-type oxidases compare across research applications?

Different analytical techniques offer complementary insights into CcoP structure and function:

Analytical TechniqueInformation ProvidedTechnical ComplexitySample RequirementsLimitations
Blue Native PAGE- Complex assembly
- Native interactions
- Molecular weight estimation
Moderate- Detergent-solubilized complexes
- Low temperature handling
- Limited resolution
- Detergent interference
- Semi-quantitative
Oxygen consumption assays- Enzymatic activity
- Substrate affinity
- Inhibitor studies
Low to moderate- Membranes or purified complex
- Controlled temperature
- Indirect measurement
- Multiple variables
- Background consumption
Chemical cross-linking- Subunit proximity
- Interaction interfaces
- Complex assembly
Moderate- Purified proteins
- Optimized conditions
- Non-specific reactions
- Complex data interpretation
- Altered protein properties
UV-Vis spectroscopy- Heme incorporation
- Redox state
- Ligand binding
Low- Relatively pure samples
- Known concentration
- Overlapping spectra
- Limited structural information
- Interference from scattering
Cryo-EM- 3D structure
- Subunit arrangement
- Conformational states
Very high- Highly pure samples
- Homogeneous preparations
- Expensive equipment
- Complex data processing
- Size limitations

For studying CcoP in the context of the entire cbb3-type oxidase complex, the combination of Blue Native PAGE and chemical cross-linking has proven particularly valuable for identifying specific CcoQ-CcoP interactions. These techniques demonstrated that CcoQ is required for stabilizing the interaction of CcoP with the CcoNO core complex in R. capsulatus, a finding that likely extends to H. pylori cbb3-type oxidase .

What emerging technologies might advance our understanding of H. pylori CcoP function?

Several cutting-edge technologies show promise for elucidating CcoP function in H. pylori:

  • Single-molecule techniques: FRET and optical tweezers could provide unprecedented insights into conformational changes during electron transfer and complex assembly.

  • Time-resolved crystallography: Capturing transient states during the catalytic cycle would reveal mechanistic details of electron flow through CcoP.

  • In-cell NMR: Monitoring structural changes in living bacterial cells could bridge the gap between in vitro and in vivo understanding.

  • Proximity labeling (BioID/APEX): Identifying the complete interactome of CcoP in H. pylori would map its role in wider cellular processes.

  • CryoET of H. pylori membrane preparations: Visualizing cbb3-type oxidase in its native membrane environment would reveal organization and interactions.

These approaches could address fundamental questions about how cbb3-type cytochrome oxidases contribute to H. pylori's unique ability to colonize the harsh gastric environment and potentially identify new therapeutic targets .

How might understanding CcoP contribute to novel therapeutic approaches for H. pylori infection?

The essential role of respiratory proteins in H. pylori survival presents opportunities for therapeutic development:

  • Targeted inhibitors: Small molecules targeting the unique features of H. pylori CcoP could selectively inhibit bacterial respiration without affecting host cytochromes.

  • Combination therapies: CcoP inhibitors could sensitize H. pylori to existing antibiotics, potentially addressing the increasing problem of antibiotic resistance.

  • Vaccine approaches: As mentioned previously, CcoP might serve as a novel antigen in vaccine development, potentially combined with established antigens like CagA.

  • Bacterial competition strategies: Engineering probiotic bacteria to outcompete H. pylori for electron acceptors by targeting vulnerabilities in the cbb3 system.

With H. pylori infection affecting approximately two-thirds of the world's population and serving as the primary cause of peptic ulcers, novel therapeutic approaches targeting essential respiratory proteins could complement existing treatment strategies .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.