Recombinant Helicobacter pylori Flagellar biosynthesis protein flhA (flhA)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Helicobacter pylori flagellar biosynthesis protein FlhA (flhA) is a genetically engineered form of FlhA, a critical component of the bacterial flagellar type III secretion system (T3SS). FlhA facilitates the assembly and regulation of flagellar structures essential for motility, colonization, and virulence in H. pylori, a pathogen linked to gastritis, peptic ulcers, and gastric cancer . Recombinant FlhA enables in vitro studies of its structural and functional roles in bacterial pathogenesis.

Functional Role in Flagellar Biosynthesis

FlhA acts as a checkpoint regulator and export gate for flagellar components:

  • Flagellar assembly: FlhA ensures sequential secretion of rod/hook-type (e.g., FlgD) and filament-type (e.g., FlaA) substrates .

  • Regulatory signaling: FlhA<sub>NT</sub> binds FlgS to activate RpoN-dependent transcription of middle-stage flagellar genes (e.g., flaB, flgE) .

  • Coordination with FlgM: FlhA interacts with the anti-sigma factor FlgM, influencing FliA activity and late-stage gene expression .

Table 2: Phenotypic Effects of FlhA Mutations

MutationEffect on H. pyloriSource
ΔflhANon-motile; no flagellar filaments
FlhA<sub>ΔNT</sub>Loss of FlgS binding; reduced flaB expression
L401A (FlhA<sub>C</sub>)Impaired filament-type substrate export

Interaction with Regulatory Proteins

FlhA collaborates with key regulators to coordinate flagellar gene expression:

  • FlgS kinase: FlhA<sub>NT</sub> binds FlgS with high affinity (K<sub>D</sub> = 21 nM), triggering RpoN-dependent transcription .

  • CsrA: FliW2 antagonizes CsrA’s repression of flaA mRNA, indirectly promoting FlaA production .

  • FliJ: The FlhA<sub>C</sub>-FliJ interaction remodels the export apparatus for substrate specificity .

Immunogenicity and Vaccine Potential

While recombinant FlaA (flagellin) has been tested as a vaccine candidate , FlhA’s regulatory role makes it a potential target for anti-motility therapies. Studies show:

  • FlaA epitopes: Induce mixed Th1/Th2 immune responses (IFN-γ: 135 pg/mL; IL-5: 8 pg/mL) .

  • FlaA antibodies: Elevated IgG2a (1.9 ± 0.26 OD<sub>490</sub>) and IgA (0.5 ± 0.13 OD<sub>490</sub>) .

Challenges in Recombinant FlhA Studies

  • Expression hurdles: Native FlhA forms membrane-associated complexes, complicating soluble recombinant production .

  • Functional assays: Reconstituting FlhA-FlgS interactions in vitro requires precise stoichiometry .

Future Directions

  • Structure-function studies: Cryo-EM analysis of full-length FlhA in lipid bilayers.

  • Therapeutic targeting: Small molecules disrupting FlhA-FlgS binding to inhibit motility.

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, kindly indicate it when placing your order and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
flhA; flbA; HP_1041; Flagellar biosynthesis protein FlhA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-733
Protein Length
full length protein
Species
Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)
Target Names
flhA
Target Protein Sequence
MANERSKLAFKKTFPVFKRFLQSKDLALVVFVIAILAIIIVPLPPFVLDFLLTISIALSV LIILIGLYIDKPTDFSAFPTLLLIVTLYRLALNVATTRMILTQGYKGPSAVSDIITAFGE FSVSGNYVIGAIIFSILVLVNLLVVTNGSTRVTEVRARFALDAMPGKQMAIDADLNSGLI DDKEAKKRRAALSQEADFYGAMDGASKFVKGDAIASIIITLINIIGGFLVGVFQRDMSLS FSASTFTILTIGDGLVGQIPALIIATATGIVATRTTQNEEEDFASKLITQLTNKSKTLVI VGAILLLFATIPGLPTFSLAFVGTLFLFIAWLISREGKDGLLTKLENYLSQKFGLDLSEK PHSSKIKPHTPTTRAKTQEELKREEEQAIDEVLKIEFLELALGYQLISLADMKQGGDLLE RIRGIRKKIASDYGFLMPQIRIRDNLQLPPTHYEIKLKGIVIGEGMVMPDKFLAMNTGFV NKEIEGIPTKEPAFGMDALWIETKNKEEAIIQGYTIIDPSTVIATHTSELVKKYAEDFIT KDEVKSLLERLAKDYPTIVEESKKIPTGAIRSVLQALLHEKIPIKDMLTILETITDIAPL VQNDVNILTEQVRARLSRVITNAFKSEDGRLKFLTFSTDSEQFLLNKLRENGTSKSLLLN VGELQKLIEVVSEEAMKVLQKGIAPVILIVEPNLRKALSNQMEQARIDVIVLSHAELDPN SNFEALGTIHINF
Uniprot No.

Target Background

Function
This protein plays a crucial role in the export of flagellum proteins.
Gene References Into Functions
  1. FlgS exhibits high-affinity interactions with a peptide comprising residues 1 to 25 of FlhA. PMID: 25802298
  2. X-ray crystallography has been employed to determine the structure of the cytoplasmic fragment of this protein from Helicobacter pylori. PMID: 20442410
  3. FlgM demonstrated a predominantly polar distribution and interacted with the C-terminal domain of FlhA (FlhA(C)). PMID: 19465658
Database Links
Protein Families
FHIPEP (flagella/HR/invasion proteins export pore) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is FlhA and what is its role in H. pylori flagellar biosynthesis?

FlhA is an essential component of the flagellar export apparatus in H. pylori. It functions as part of the type III secretion system required for flagellar protein export and assembly. Beyond its structural role, FlhA serves as a key regulatory protein in flagellar gene expression. The protein contains important cytoplasmic domains that interact with other flagellar components and regulatory proteins .

Experimental evidence confirms that FlhA is absolutely required for motility in H. pylori, as deletion mutants (ΔflhA) show complete loss of motility in soft agar tests . FlhA's role extends beyond physical export of flagellar components—it participates in coordinating gene expression with flagellar assembly through interaction with regulatory proteins.

How does recombinant FlhA protein interact with the H. pylori flagellar gene regulatory system?

FlhA interacts directly with the two-component system consisting of the histidine kinase FlgS and response regulator FlgR, which controls transcription of middle-stage flagellar genes. The N-terminal cytoplasmic sequence of FlhA (particularly residues 1-25, designated FlhA NT) binds with high affinity to the C-terminal kinase domain of FlgS .

This interaction is characterized by:

  • A high-affinity binding with equilibrium dissociation constant (KD) of 21 nM

  • Fast-on kinetics (kon = 2.9 × 10⁴ M⁻¹s⁻¹)

  • Slow-off kinetics (koff = 6.2 × 10⁻⁴ s⁻¹)

The binding of FlhA to FlgS is believed to facilitate interactions between FlgS and other structures required to stimulate autophosphorylation, though binding alone does not directly stimulate FlgS autophosphorylation in vitro .

What expression systems are commonly used for recombinant FlhA production?

Several expression systems have been successfully used for recombinant FlhA production:

Expression SystemAdvantagesApplications
E. coli BL21DE3High yield (40-50% of total protein), well-established protocolsImmunological studies, structural analysis
YeastPost-translational modifications, potential for improved foldingComplex functional studies
BaculovirusEukaryotic processing, handling of large proteinsImmunization studies
Mammalian CellNative-like modifications, complex foldingAdvanced functional studies

For basic research applications, E. coli expression systems with pET vectors (such as pET32a) have been successfully employed, particularly for immunological studies of FlhA .

How does the deletion of FlhA's N-terminal cytoplasmic domain affect flagellar gene expression and assembly?

Deletion of the N-terminal cytoplasmic sequence of FlhA has profound effects on both gene expression and flagellar assembly:

  • Gene expression effects:

    • Dramatic decrease in expression of RpoN-dependent genes, particularly flaB and flgE

    • Disruption of the RpoN and FlgR-dependent transcriptional pathway

    • Reduction in expression of class 2 and class 3 flagellar genes

  • Flagellar assembly effects:

    • Complete loss of motility in soft agar assays

    • Inability to complement ΔflhA mutations with FlhA variants lacking residues 2-24

Methodologically, these effects have been demonstrated through:

  • Construction of flhA alleles with in-frame deletions of codons 2-24

  • Complementation experiments with wild-type and mutant alleles

  • Analysis of gene expression through transcriptional reporter assays

  • Motility assays in soft agar medium

Interestingly, expression of truncated FlhA (FlhAΔNT) in wild-type H. pylori inhibits motility, suggesting the truncated protein can be incorporated into the export apparatus but disrupts its function, supporting a dominant-negative effect .

What molecular mechanisms explain the interaction between FlhA and the FlgS/FlgR two-component system?

The interaction between FlhA and the FlgS/FlgR two-component system involves several molecular mechanisms:

  • Direct binding: The N-terminal 25 amino acids of FlhA (FlhANT) bind with high affinity to the C-terminal kinase domain of FlgS with a KD of 21 nM .

  • Signal transduction pathway:

    • FlhA binding to FlgS does not directly stimulate FlgS autophosphorylation in vitro

    • FlhA likely facilitates interactions between FlgS and other structures required for autophosphorylation

    • Once phosphorylated, FlgS transfers the phosphate to FlgR

    • Phosphorylated FlgR initiates transcription from RpoN-dependent promoters

  • Transcriptional regulation: The FlhA-FlgS-FlgR pathway controls expression of middle-stage flagellar genes, including flaB (flagellin B) and flgE (hook protein) .

Research methodology for investigating these interactions includes:

  • Optical biosensing to measure binding kinetics and affinity

  • In vitro phosphorylation assays

  • Gene expression analysis using transcriptional reporters

  • Site-directed mutagenesis to identify critical residues

These findings establish FlhA as a key coordinator that links physical flagellar assembly with gene regulation through direct protein-protein interactions .

How does FlhA function in the hierarchical regulation of flagellar gene expression in H. pylori?

FlhA functions within a complex hierarchical regulatory network controlling flagellar gene expression in H. pylori:

  • Regulatory hierarchy:

    • FlhA and FlhF serve as functional equivalents to master regulators in H. pylori

    • Inactivation of flhA leads to negative transcriptional regulation of class 2 flagellar genes

    • FlhA controls genes in both the RpoN (σ54) regulon and FliA (σ28) regulon

  • Feedback regulation:

    • FlhA participates in FlgM-dependent feedback control of the RpoN regulon

    • FlgM (anti-sigma factor) is involved in FlhA-dependent feedback but not in FlhF-dependent feedback

  • Regulatory network:

    • Unlike other bacteria, H. pylori lacks a true master regulator of flagellar biosynthesis

    • The FlhA-dependent regulon includes both flagellar and non-flagellar genes

    • FlhA influences 24 genes attributed to intermediate regulons under control of multiple promoters

This complex regulation reflects the essential nature of flagellar motility for H. pylori survival in the gastric environment. Methodologically, these regulatory networks have been elucidated through genome-wide analysis using microarray technology and targeted gene disruption .

What are the methodological challenges in producing functional recombinant FlhA for structural studies?

Production of functional recombinant FlhA presents several methodological challenges:

  • Membrane protein expression issues:

    • FlhA is a membrane-associated protein with multiple transmembrane domains

    • Expression often results in inclusion body formation requiring refolding

    • Maintaining native conformation during purification is difficult

  • Technical approaches:

    • Use of fusion tags (e.g., thioredoxin in pET32a system) can enhance solubility

    • Detergent screening is critical for extracting and maintaining protein stability

    • Stepwise refolding protocols may be necessary for proteins recovered from inclusion bodies

  • Verification of functionality:

    • Binding assays with known interaction partners (e.g., FlgS)

    • Circular dichroism to confirm secondary structure elements

    • Limited proteolysis to assess proper folding

  • Expression system selection:

    • E. coli systems provide high yield but may lack proper folding

    • Eukaryotic systems (yeast, insect cells) may better handle complex membrane proteins

    • Cell-free systems offer an alternative for difficult-to-express membrane proteins

How can recombinant FlhA be utilized in developing vaccines against H. pylori?

Recombinant FlhA shows potential as a vaccine candidate against H. pylori infection:

  • Immunological properties:

    • FlhA is expressed by nearly all H. pylori clinical isolates

    • As a conserved flagellar protein, it presents fewer strain variation issues than some antigens

    • Can induce specific antibody responses

  • Vaccine development approaches:

    • Recombinant protein subunit vaccines using purified FlhA

    • DNA vaccines encoding FlhA

    • Combined antigen approaches (FlhA with other conserved antigens)

    • Mucosal delivery systems targeting the gastric environment

  • Adjuvant considerations:

    • Plant polysaccharides have shown promise with other H. pylori flagellar proteins

    • CpG adjuvants carrying H. pylori lipopolysaccharide enhance immune responses

    • Selection should favor induction of appropriate T-helper responses

  • FlaA and FlaB are expressed by 100% and 98.98% of clinical isolates, respectively

  • Antibodies against FlaA and FlaB were found in 98.4% and 92.8% of H. pylori infected patients

  • Recombinant FlaA and FlaB show satisfactory immunoreactivity and antigenicity

These data suggest that combining FlhA with established candidates like FlaA/FlaB might enhance vaccine efficacy through targeting multiple components of the flagellar apparatus.

How does the role of FlhA in H. pylori compare to its homologs in other bacteria?

FlhA's role in H. pylori shows both similarities and important differences compared to its homologs in other bacteria:

  • Conserved functions:

    • In both H. pylori and Salmonella, FlhA is required for motility and flagellar type III secretion

    • The N-terminal cytoplasmic sequence is essential in both organisms

    • FlhA serves as part of the export apparatus in the flagellar system across species

  • H. pylori-specific functions:

    • FlhA in H. pylori has a direct role in gene regulation through FlgS/FlgR interaction

    • H. pylori FlhA functions as a functional equivalent to master regulators, which are absent in H. pylori

    • FlhA influences both flagellar and non-flagellar genes in H. pylori

  • Comparative structural elements:

    • In Salmonella, deletion of residues 18-22 of FlhA still allows complementation, while deletion of residues 2-22 eliminates function

    • In H. pylori, deletion of residues 2-24 completely eliminates function

    • Interaction with FliI has been proposed for Salmonella FlhA, while interaction with FlgS is established for H. pylori FlhA

These differences likely reflect H. pylori's unique flagellar regulatory network, which lacks a true master regulator and instead relies on proteins like FlhA and FlhF to coordinate flagellar gene expression with assembly .

What experimental approaches best elucidate the interaction between FlhA and other flagellar proteins?

Several experimental approaches have proven effective for studying FlhA interactions:

  • Optical biosensing techniques:

    • Surface plasmon resonance for real-time kinetic analysis

    • Bio-layer interferometry for measuring binding constants

    • These techniques revealed the high-affinity interaction between FlhA-NT and FlgS (KD = 21 nM)

  • Protein domain mapping:

    • Expression of truncated protein fragments to identify interaction domains

    • Peptide array analysis for fine mapping of binding sites

    • These approaches identified the C-terminal kinase domain of FlgS as the binding site for FlhA-NT

  • Genetic complementation assays:

    • Construction of deletion mutants (e.g., ΔflhA)

    • Complementation with plasmids expressing wild-type or mutant alleles

    • Motility assessments in soft agar

    • These methods confirmed the requirement of the N-terminal sequence for FlhA function

  • Gene expression analysis:

    • Transcriptional reporters to monitor RpoN-dependent genes

    • Western blotting to assess protein expression levels

    • These techniques demonstrated the regulatory connection between FlhA and flagellar gene expression

  • Structural biology approaches:

    • X-ray crystallography of protein domains

    • Cryo-electron microscopy of protein complexes

    • These methods could provide atomic-level details of interaction interfaces

The combination of these approaches has been crucial for establishing FlhA's dual role in both the physical assembly of flagella and the regulation of flagellar gene expression .

How can researchers address the challenges in creating stable FlhA deletion mutants?

Creating stable FlhA deletion mutants presents specific challenges due to FlhA's essential role in H. pylori:

  • Methodological approach:

    • Replace the region corresponding to ~90 nucleotides upstream of the start codon through codon 77 of flhA with a selectable marker (e.g., chloramphenicol resistance cassette)

    • Use natural transformation for introducing the mutation

    • Confirm mutation by PCR and sequencing of the resulting amplicon

  • Complementation strategy:

    • Express flhA alleles from the native flhA promoter

    • Use shuttle vectors such as pHel3 that are stable in H. pylori

    • Create in-frame deletions (e.g., codons 2-24) using overlapping PCR

  • Verification approaches:

    • Motility assays in soft agar medium

    • Western blotting to confirm protein expression

    • RT-PCR to assess effects on downstream gene expression

    • Microscopy to evaluate flagellar assembly

  • Troubleshooting considerations:

    • Polar effects on downstream genes must be carefully evaluated

    • Complementation with wild-type flhA may only partially restore motility

    • Expression of truncated FlhA (FlhAΔNT) in wild-type cells may inhibit motility through dominant-negative effects

These approaches have been successfully used to generate and characterize flhA mutants in H. pylori strains B128 and ATCC 43504 .

What are the key considerations for designing experiments to investigate FlhA's role in flagellar assembly checkpoints?

When investigating FlhA's role in flagellar assembly checkpoints, researchers should consider:

  • Experimental design strategy:

    • Create a panel of mutants in key flagellar genes (flhA, flhB1, flhB2, flhF, fliA, fliF, fliI, fliP, rpoN)

    • Analyze protein expression profiles in each mutant background

    • Compare flagellar gene expression patterns across mutants

    • Assess flagellation patterns and motility phenotypes

  • Analysis techniques:

    • SDS-PAGE and Western blotting to assess FlgM localization and secretion

    • Whole-genome microarray analysis to identify genes affected by mutations

    • Electron microscopy to evaluate flagellar structure and number

    • Motility assays to correlate gene expression with functional outcomes

  • Key findings to consider:

    • FlgM expression is low in flhB1, flhF, fliP, and rpoN mutants and almost undetectable in flhB2, fliA, and fliF mutants

    • This suggests that transcript abundance, translation, or stability of FlgM depends on these flagellar proteins

    • FlhA and FlhF function as equivalents to master regulators in H. pylori

  • Interpretation framework:

    • Assess both structural and regulatory roles of FlhA

    • Consider feedback loops in flagellar gene regulation

    • Evaluate hierarchical dependencies in flagellar assembly checkpoints

These approaches help elucidate how FlhA coordinates flagellar gene expression with the physical assembly of the flagellum, providing insight into H. pylori's unique regulatory network that lacks a true master regulator .

How should researchers interpret contradicting results about FlhA's role in different H. pylori strains?

When faced with contradicting results about FlhA's role across different H. pylori strains, researchers should consider:

  • Strain-specific variations:

    • H. pylori exhibits high genetic diversity between strains

    • Genomic plasticity may lead to differences in regulatory networks

    • Compare complete genome sequences when available to identify potential modifying factors

  • Methodological considerations:

    • Experimental conditions (culture media, growth phase, temperature)

    • Methods of creating and complementing mutations

    • Sensitivity and specificity of detection methods

    • Consistency of phenotypic assays across studies

  • Analysis framework:

    • Create a table comparing key findings across strains:

    StrainFlhA FunctionFlagellation PatternGene Expression EffectsReference
    G27MRequired for proper flagella localizationHypoflagellation in ΔflhANot specified
    B128Required for proper flagella localizationHypoflagellation in ΔflhANot specified
    ATCC 43504Required for RpoN-dependent gene expressionNot specifiedDecreased expression of flaB and flgE
    N6/88-3887Required for FlgM expression/localizationNot specifiedFlgM expression affected
  • Reconciliation strategies:

    • Focus on conserved functions across strains

    • Investigate strain-specific differences as potential adaptations

    • Design experiments to directly compare strains under identical conditions

    • Consider epistatic interactions with strain-specific genetic elements

This systematic approach helps distinguish fundamental FlhA functions from strain-specific variations, providing a more comprehensive understanding of its role in H. pylori flagellar biosynthesis .

What are the promising approaches for developing FlhA-based diagnostic tools for H. pylori infection?

Several approaches show promise for developing FlhA-based diagnostic tools:

  • Serological detection systems:

    • Development of ELISA assays using recombinant FlhA

    • Multiplex serological assays combining FlhA with other flagellar proteins (FlaA, FlaB)

    • Lateral flow immunoassays for point-of-care testing

  • Molecular detection methods:

    • PCR-based detection of flhA gene sequences

    • RNA-based detection of flhA transcripts

    • CRISPR-based diagnostic platforms targeting flhA sequences

  • Considerations for diagnostic performance:

    • While FlaA and FlaB antibodies were detected in 98.4% and 92.8% of H. pylori infected patients, respectively, similar data for FlhA needs to be established

    • Conservation of FlhA across H. pylori strains supports its potential as a diagnostic target

    • Combining FlhA with other markers may increase sensitivity and specificity

  • Research methodology for validation:

    • Screening of serum samples from H. pylori-positive and negative patients

    • Correlation with established diagnostic methods (urea breath test, histology)

    • Assessment of cross-reactivity with other Helicobacter species

The high conservation of flhA across H. pylori strains and its essential role in bacterial motility make it a promising target for diagnostic development, though more research is needed to establish its sensitivity and specificity compared to established antigens like FlaA and FlaB .

What structural biology techniques would best advance our understanding of FlhA's function?

Advanced structural biology techniques that would enhance our understanding of FlhA include:

  • Cryo-electron microscopy (cryo-EM):

    • Visualization of the entire flagellar export apparatus with FlhA in situ

    • Structure determination of FlhA in complex with interaction partners

    • Analysis of conformational changes during the export process

  • X-ray crystallography:

    • High-resolution structures of FlhA domains

    • Co-crystallization with binding partners (e.g., FlgS)

    • Structure-based drug design targeting FlhA

  • Nuclear magnetic resonance (NMR) spectroscopy:

    • Solution structure of FlhA cytoplasmic domains

    • Analysis of dynamics and conformational changes

    • Mapping of interaction interfaces with binding partners

  • Integrative structural biology approaches:

    • Combining multiple techniques (cryo-EM, X-ray, NMR)

    • Hydrogen-deuterium exchange mass spectrometry to map dynamic regions

    • Cross-linking mass spectrometry to identify interaction sites

  • Computational modeling:

    • Molecular dynamics simulations of FlhA in membranes

    • Protein-protein docking studies

    • Prediction of conformational changes during function

These approaches would help elucidate how FlhA coordinates its dual roles in flagellar protein export and gene regulation, providing targets for potential therapeutic interventions against H. pylori .

How might gene editing technologies be applied to study FlhA function in H. pylori?

Modern gene editing technologies offer new approaches to study FlhA function:

  • CRISPR-Cas9 applications:

    • Creation of precise deletions, insertions, or point mutations in flhA

    • Introduction of tagged versions of FlhA for localization studies

    • Simultaneous editing of multiple genes to study genetic interactions

  • Base editing approaches:

    • Introduction of specific amino acid changes without double-strand breaks

    • Study of structure-function relationships through systematic mutagenesis

    • Creation of FlhA variants analogous to the FliF N255D variant that enhances flagellation

  • Conditional expression systems:

    • Development of inducible or repressible flhA expression

    • Temporal control of FlhA production to study assembly checkpoints

    • Tissue-specific expression in animal infection models

  • In vivo imaging techniques:

    • Fluorescent protein fusions to track FlhA localization

    • FRET sensors to monitor FlhA interactions

    • Real-time visualization of flagellar assembly

  • Methodological considerations:

    • H. pylori transformation efficiency limitations

    • Selection markers appropriate for clinical isolates

    • Validation of genetic modifications at both DNA and protein levels

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.