Recombinant Helicobacter pylori Flagellar biosynthetic protein flhB (flhB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them when placing the order. We will fulfill your request based on availability.
Lead Time
Delivery time may vary depending on the purchasing method or location. For specific delivery times, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage state, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing it accordingly.
Synonyms
flhB; HP_0770; Flagellar biosynthetic protein FlhB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-358
Protein Length
full length protein
Species
Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)
Target Names
flhB
Target Protein Sequence
MAEEEKTELPSAKKIQKAREEGNVPKSMEVVGVLGLLAGLISIFVFFIWWVDGFSEMYRH VLKDFSLDFSKESVQELFNQLAKDTFLLLLPILIILVVVAFLSNVLQFGWLFAPKVIEPK FSKINPINGVKNLFSLKKLLDGSLITLKVFLAFFLGFFIFSLFLGELNHAALLNLQGQLL WFKNKALWLISSLLFLFFVLAFIDLAIKRRQYTNSLKMTKQEVKDEYKQQEGNPEIKAKI RQMMLKNATNKMMQEIPKANVVVTNPTHYAVALKFDEEHPVPVVVAKGTDYLAIRIKGIA REHDIEIIENKTLARELYRDVKLNAAIPEELFEAVAIVFAQVAKLEQERQKQKIIKPL
Uniprot No.

Target Background

Function
FlhB is essential for the formation of the rod structure in the basal body of the flagellar apparatus. In collaboration with FliI and FliH, it may constitute the export apparatus for flagellin.
Gene References Into Functions
  1. The role of FlhB (HP0770) and its C-terminal homologue HP1575 was investigated. Deletion of HP0770 resulted in the absence of swimming motility. PMID: 17050924
Database Links
Protein Families
Type III secretion exporter family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the fundamental role of FlhB in H. pylori flagellar assembly?

FlhB serves as an integral membrane protein in the flagellar export apparatus of H. pylori, functioning primarily as a substrate specificity switch that controls the export of different flagellar proteins during assembly. The protein resides in the central pore of the basal body complex, closely associated with FlhA, where it acts as a gating mechanism that prevents incorrect flagellar proteins from being exported into the growing flagellar structure . During the flagellar assembly process, FlhB facilitates the critical switch from exporting rod- and hook-type proteins to filament and filament cap proteins . This substrate specificity switching is essential for the proper sequential assembly of the flagellar structure, which ultimately enables bacterial motility—a key virulence factor for H. pylori colonization and persistence in the gastric environment .

What expression systems are commonly used for recombinant H. pylori FlhB production?

Recombinant production of H. pylori FlhB typically employs Escherichia coli expression systems, similar to approaches used for other H. pylori proteins. While the search results don't specifically detail FlhB expression systems, the methodologies used for recombinant H. pylori adhesin protein (HpaA) provide a relevant model. E. coli BL21(DE3) is a preferred strain for expressing H. pylori proteins due to its reduced protease activity and high expression efficiency . For optimal expression, researchers typically use vectors containing strong inducible promoters like T7, with expression induced by IPTG (isopropyl β-D-1-thiogalactopyranoside) . The purification of recombinant FlhB would likely involve affinity chromatography, often utilizing histidine tags for enhanced purification efficiency, followed by size-exclusion chromatography to ensure protein homogeneity . When expressing membrane proteins like FlhB, researchers must address additional challenges related to protein solubility, proper folding, and potential toxicity to the host cells, which might require specialized culture conditions or fusion tags to improve expression yields.

How can culture media be optimized for maximal recombinant FlhB expression in E. coli?

Optimizing culture media for recombinant FlhB expression would require a systematic approach similar to that employed for other H. pylori proteins. The process should begin with a one-factor-at-a-time experimental design to identify key nutritional components affecting expression levels, followed by statistical experimental designs to determine optimal concentrations and interactions . Based on successful approaches with other H. pylori recombinant proteins, researchers should evaluate carbon sources (particularly glucose), nitrogen sources (such as NH₄Cl, yeast extract, and yeast peptone), and essential minerals (like CaCl₂) . Statistical computational models, including Response Surface Methodology (RSM) and Artificial Neural Network linked Genetic Algorithm (ANN-GA), are highly effective for optimizing these parameters simultaneously . The ANN-GA approach has demonstrated superior predictive accuracy in previous studies, potentially increasing yields by over 90% compared to standard media formulations . Additionally, optimization should consider induction timing, culture temperature, and dissolved oxygen levels, as these parameters significantly affect membrane protein expression and folding.

The optimization process might follow this general experimental design:

Parameter CategoryKey Components to OptimizeOptimization Method
Carbon SourcesGlucose, glycerolPlackett-Burman design
Nitrogen SourcesNH₄Cl, yeast extract, yeast peptonePlackett-Burman design
Mineral ComponentsCaCl₂, phosphates, trace metalsPlackett-Burman design
Physical ParametersTemperature, pH, oxygen levelsRSM or ANN-GA
Induction ConditionsIPTG concentration, induction timingRSM or ANN-GA

What techniques are most effective for studying the cleavage mechanism of FlhB protein?

Investigating the cleavage mechanism of H. pylori FlhB requires a combination of molecular, biochemical, and structural approaches. Site-directed mutagenesis is fundamental for analyzing the cleavage site between Asn269 and Pro270, allowing researchers to create specific amino acid substitutions to determine which residues are essential for the cleavage process . Western blot analysis using antibodies against different domains of FlhB or utilizing tagged versions (such as N- or C-terminal His-tagged FlhB constructs) enables detection of both processed and unprocessed forms of the protein . For detailed structural insights, X-ray crystallography or cryo-electron microscopy of the cytoplasmic domain can reveal the three-dimensional arrangement that facilitates auto-cleavage . Mass spectrometry techniques, particularly liquid chromatography-tandem mass spectrometry (LC-MS/MS), are invaluable for confirming the exact cleavage site and identifying any post-translational modifications that might influence the process.

In vitro cleavage assays using purified recombinant FlhB can determine whether the process is autocatalytic or requires additional factors, while pulse-chase experiments can reveal the kinetics of FlhB processing in vivo . To understand the broader biological context, complementation studies in FlhB-deletion mutants can test the functionality of cleavage-site variants, correlating structural findings with biological outcomes such as flagellar assembly and bacterial motility . These various approaches should be integrated to build a comprehensive model of the cleavage mechanism and its regulation in the context of flagellar assembly.

How do researchers validate the functionality of recombinant FlhB in experimental systems?

Validating recombinant FlhB functionality requires multiple complementary approaches spanning biochemical, structural, and biological analyses. The primary validation method involves complementation studies in H. pylori FlhB-knockout strains, where successful restoration of flagellar assembly and motility provides direct evidence of functional recombinant protein . Motility can be quantitatively assessed using soft agar motility assays, while flagellar structure can be visualized through electron microscopy techniques . Biochemically, researchers must verify that recombinant FlhB undergoes proper cleavage at the Asn269-Pro270 site, using Western blot analysis to detect both the FlhBTM+CN and FlhBCC fragments that result from processing . In vitro flagellar protein export assays can directly assess whether the recombinant FlhB correctly mediates the substrate specificity switch from hook-type to filament-type protein export .

Structural integrity can be evaluated using circular dichroism spectroscopy to confirm proper protein folding, while protein-protein interaction studies (such as pull-down assays or surface plasmon resonance) can verify that recombinant FlhB maintains appropriate interactions with other flagellar export apparatus components like FlhA and the hook length control protein FliK . Additionally, researchers might employ fluorescently tagged recombinant FlhB to confirm proper localization to the flagellar basal body using fluorescence microscopy. Together, these methods provide a comprehensive validation approach that connects structural features with biological function.

What are the key experimental challenges in studying H. pylori FlhB processing?

Studying H. pylori FlhB processing presents several significant experimental challenges. The membrane-associated nature of FlhB makes it inherently difficult to work with, as the protein contains multiple transmembrane domains that complicate expression, purification, and structural studies . Ensuring proper folding and maintaining stability of the recombinant protein outside its native membrane environment often requires specialized detergents or lipid reconstitution systems . The auto-cleavage process itself presents a timing challenge—researchers must develop protocols that capture both pre- and post-cleavage states to fully understand the mechanism, potentially requiring rapid purification methods or specific inhibitors to trap intermediates .

Another major challenge is the potential toxicity of overexpressed FlhB to bacterial host cells, similar to what has been observed with YscU (a FlhB homolog) in Yersinia pseudotuberculosis . This toxicity may necessitate tightly controlled induction systems or the use of specialized host strains. The unique "spare part" mechanism in H. pylori involving the HP1575 protein further complicates studies, as researchers must account for potential compensatory effects that may mask phenotypes in genetic studies . Additionally, reconstituting a functional flagellar export system in vitro to study FlhB's substrate-switching activity is technically demanding, requiring multiple purified components assembled in the correct stoichiometry and orientation. These challenges necessitate creative experimental approaches that combine in vivo and in vitro methods to build a complete picture of FlhB processing and function.

How can structural biology techniques be applied to understand FlhB conformational changes during flagellar assembly?

Structural biology techniques offer powerful approaches for elucidating the conformational changes in FlhB during flagellar assembly. X-ray crystallography provides high-resolution structural information but requires protein crystallization, which can be challenging for membrane proteins like FlhB . To overcome this limitation, researchers often focus on the soluble cytoplasmic domain, which contains the critical cleavage site . Cryo-electron microscopy (cryo-EM) has emerged as a revolutionary technique that can potentially capture FlhB in different conformational states without crystallization, allowing visualization of the protein in a more native-like environment and potentially revealing the structural basis for substrate specificity switching .

What methods are most effective for analyzing the interactions between FlhB and other flagellar proteins?

Analyzing interactions between FlhB and other flagellar proteins requires a multi-faceted approach combining in vivo and in vitro techniques. Co-immunoprecipitation (Co-IP) represents a foundational method for identifying physiologically relevant protein-protein interactions, where antibodies against FlhB can pull down interacting partners from H. pylori lysates, followed by mass spectrometry identification . For quantitative binding measurements, surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) can determine binding affinities and thermodynamic parameters between purified FlhB domains and potential partner proteins, such as the hook length control protein FliK .

Bacterial two-hybrid or yeast two-hybrid systems offer genetic approaches to screen for potential interactions, though these may require careful design to accommodate membrane proteins like FlhB . For mapping specific interaction domains, hydrogen-deuterium exchange mass spectrometry (HDX-MS) can identify regions that become protected upon complex formation, while cross-linking mass spectrometry (XL-MS) can capture transient interactions by covalently linking proteins in close proximity before analysis . Fluorescence techniques such as Förster resonance energy transfer (FRET) or bioluminescence resonance energy transfer (BRET) enable visualization of protein interactions in living bacteria, providing spatial and temporal information about FlhB associations during flagellar assembly .

In vitro reconstitution systems using purified components represent the gold standard for defining direct interactions and functional consequences. These systems might include liposome-reconstituted FlhB combined with soluble flagellar proteins to test export functionality and specificity in a controlled environment. Integration of these diverse approaches allows researchers to build comprehensive interaction maps that explain how FlhB coordinates with other flagellar proteins to regulate the assembly process.

How does the HP1575 "spare part" mechanism function when the primary FlhBCC domain is compromised?

The unique "spare part" mechanism involving HP1575 represents an intriguing adaptation in H. pylori flagellar assembly. When the FlhBCC domain (HP0770) is deleted or compromised, the homologous HP1575 protein appears to functionally substitute for it, enabling continued flagellar export and assembly . Current understanding suggests that HP1575 likely shares significant structural and functional similarity with the FlhBCC domain despite limited sequence homology . The mechanism likely involves HP1575 interacting directly with the remaining FlhBTM+CN fragment to reconstitute a functional substrate-switching complex .

Research indicates that this complementation is specific to the C-terminal domain and appears to be a specialized adaptation in H. pylori not observed in other bacterial species . The biological significance of this redundancy may relate to H. pylori's need to maintain motility under changing gastric conditions, providing a fail-safe mechanism to ensure flagellar assembly even when the primary FlhB protein is damaged . To fully understand this mechanism, researchers would need to investigate the regulation of HP1575 expression, its subcellular localization, and whether it undergoes any processing similar to FlhB . Structural studies comparing HP1575 with the FlhBCC domain would reveal conservation in key functional regions, while interaction studies could determine whether HP1575 binds to the same flagellar export apparatus components as FlhBCC . This redundancy mechanism might represent an important target for H. pylori-specific antimotility compounds, as dual inhibition of both HP0770 and HP1575 would likely be required for complete flagellar disruption.

What role do post-translational modifications play in regulating FlhB function?

Post-translational modifications (PTMs) likely play significant regulatory roles in FlhB function, though this area remains underexplored. The primary known modification is the autocleavage between Asn269 and Pro270, which is essential for the substrate-specificity switch during flagellar assembly . This cleavage generates two fragments—FlhBTM+CN and FlhBCC—that remain associated to form a functional complex . Beyond this well-characterized processing event, other potential PTMs might include phosphorylation, which could regulate the timing of the substrate-specificity switch or interactions with other flagellar proteins . Mass spectrometry-based proteomics approaches would be essential for comprehensively identifying PTMs on FlhB in various growth conditions or stages of flagellar assembly.

Researchers should investigate whether environmental stressors that H. pylori encounters in the gastric environment, such as pH fluctuations or reactive oxygen species, trigger specific modifications that regulate FlhB activity . Additionally, the potential for regulatory protease-mediated processing beyond the primary cleavage site could provide another layer of control over flagellar assembly . Site-directed mutagenesis to create non-modifiable variants of potential PTM sites, coupled with functional assays, would help establish the biological significance of any identified modifications. Understanding the role of PTMs in FlhB function could reveal mechanisms by which H. pylori coordinates flagellar assembly with environmental sensing and adaptation, potentially offering new targets for therapeutic intervention that disrupt this coordination.

How do differences in FlhB function contribute to strain-specific variations in H. pylori motility and virulence?

Strain-specific variations in H. pylori FlhB may significantly impact bacterial motility patterns and virulence capabilities. H. pylori strains exhibit considerable genetic diversity, and differences in FlhB sequence or expression could translate to functional variations that affect flagellar assembly efficiency, substrate specificity, or regulatory responsiveness . These variations might explain observed differences in swimming behavior, chemotactic responses, or flagellar morphology between clinical isolates . Comparative genomic analyses of flhB sequences from diverse H. pylori strains, coupled with phenotypic characterization of motility and colonization efficiency, would help establish correlations between specific FlhB variants and virulence-related traits.

The relative expression or activity of the HP1575 "spare part" mechanism might also vary between strains, potentially providing differential resilience to stressors that compromise the primary FlhB protein . Such variations could influence a strain's ability to maintain motility under adverse conditions, affecting persistent colonization . Additionally, strain-specific differences in the interaction between FlhB and FliK might influence hook length control, potentially resulting in flagella with different hydrodynamic properties optimized for different gastric niches .

To investigate these relationships, researchers could perform allelic exchange experiments, swapping flhB genes between strains with different motility phenotypes to determine if FlhB differences are causal. Structural studies comparing FlhB variants from different strains might reveal alterations in key functional regions that explain phenotypic differences. Understanding these strain-specific variations has important implications for H. pylori pathogenesis models and could potentially inform targeted therapeutic approaches against particularly virulent strains.

What are the emerging therapeutic applications targeting H. pylori FlhB?

FlhB represents a promising target for novel H. pylori therapeutic strategies due to its essential role in flagellar assembly and bacterial motility. Targeting FlhB offers several advantages over conventional antibiotic approaches, as motility inhibitors would not necessarily kill bacteria but rather reduce their ability to colonize and persist in the gastric environment, potentially lowering the risk of resistance development . Small molecule inhibitors designed to interfere with the FlhB cleavage process could prevent the critical substrate-specificity switch, thereby disrupting flagellar assembly . Alternatively, compounds that disrupt the interaction between FlhB and other flagellar export apparatus components could similarly compromise motility without exerting strong selective pressure for resistance .

The unique "spare part" mechanism involving HP1575 presents both a challenge and an opportunity—effective therapeutic strategies might need to target both the primary FlhB and its functional homologue simultaneously to prevent compensatory mechanisms . Peptide-based inhibitors designed to mimic key interaction domains of FlhB represent another promising approach, potentially interfering with essential protein-protein interactions in the flagellar export system . These anti-motility strategies could be combined with traditional antibiotics in reduced doses, potentially enhancing efficacy while minimizing resistance development . As research continues to elucidate the structural and functional details of H. pylori FlhB, increasingly targeted therapeutic approaches will emerge that could significantly improve treatment outcomes for H. pylori infections, particularly for antibiotic-resistant strains that currently pose a major clinical challenge.

How might future research directions expand our understanding of FlhB's role beyond flagellar assembly?

Future research on H. pylori FlhB is likely to reveal functions extending beyond its established role in flagellar assembly. Emerging evidence from other bacterial species suggests that flagellar export apparatus proteins can influence diverse cellular processes through regulatory cross-talk . In Pseudomonas putida, FlhB appears to be involved in solvent tolerance mechanisms, while in Campylobacter jejuni, flhB inactivation affects cell shape—suggesting broader cellular roles that might also exist in H. pylori . Investigating potential connections between FlhB and stress response pathways could reveal how H. pylori coordinates motility with adaptation to changing gastric conditions .

The flagellar export system shares evolutionary origins with type III secretion systems, raising the possibility that H. pylori FlhB might influence the export of non-flagellar virulence factors . Proteomics and transcriptomics studies comparing wild-type and flhB mutant strains under various stress conditions could identify previously unrecognized regulatory networks involving FlhB . Additionally, exploring potential interactions between FlhB and cell division machinery might reveal coordination mechanisms between flagellar assembly and cell cycle progression .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.