Recombinant Helicobacter pylori NADH-quinone oxidoreductase subunit K (nuoK)

What is the function of NADH-quinone oxidoreductase subunit K (nuoK) in Helicobacter pylori?

NADH-quinone oxidoreductase subunit K (nuoK) is a critical component of the NADH:ubiquinone oxidoreductase complex (Complex I) in H. pylori. This protein functions within the membrane-embedded portion of Complex I, which is involved in the electron transport chain and energy metabolism of the bacterium. The nuoK protein specifically contributes to proton translocation across the membrane, playing an essential role in cellular respiration and energy production. The entire nuo operon has been implicated in antimicrobial resistance mechanisms, particularly against benzimidazole derivatives, suggesting that nuoK may contribute to H. pylori's adaptive capabilities .

What is the molecular structure and composition of recombinant H. pylori nuoK?

Recombinant H. pylori nuoK is a small membrane protein consisting of 100 amino acids with the sequence: MIGLNHYLIVSGLLFCIGLAGMLKRKNILLLFFSTEIMLNAINIGFIAISKYTHNLDGQMFALFIIAIAASEVAIGLGLVILWFKKYKSLDIDSLNAMKG . The protein has a predominantly hydrophobic character with multiple transmembrane domains, consistent with its function in the membrane component of the respiratory chain. When expressed recombinantly with tags (such as His-tag), the protein maintains its structural integrity while allowing for purification. The hydrophobic nature of nuoK necessitates specialized handling techniques and detergent-based buffer systems for extraction and purification .

How does nuoK interact with other subunits of the NADH-quinone oxidoreductase complex?

NuoK interacts with adjacent subunits in the membrane arm of Complex I, particularly with nuoA, nuoH, nuoJ, nuoN, and potentially nuoL. These interactions form a proton-conducting channel within the membrane domain. Structural analyses suggest that nuoK is positioned strategically to allow conformational changes transmitted from the peripheral arm (where electron transfer occurs) to drive proton translocation across the membrane. Mutations in specific regions of nuoD (G398S, F404S, and V407M) affect the function of the entire complex, indicating interconnectedness between the subunits . These interactions are critical for the complex's role in energy transduction, where electron transfer from NADH to ubiquinone drives proton pumping across the membrane.

What are the optimal conditions for expressing recombinant H. pylori nuoK in E. coli?

Optimal expression of recombinant H. pylori nuoK in E. coli requires careful consideration of several parameters:

• Expression system: A pET-based expression system (such as pET28a) with an inducible T7 promoter in E. coli BL21(DE3) strain provides controlled expression .

• Medium composition: A modified medium containing:

  • Glucose as the primary carbon source (superior to other carbon sources)

  • Mixed nitrogen sources: yeast extract (5 g/L) combined with NH₄Cl as an inorganic nitrogen supplement

  • Supplemental ions: Ca²⁺ (as CaCl₂) enhances protein production

  • Phosphate buffer mixture for pH stability

• Induction conditions:

  • Culture to OD₆₀₀ of 0.6-0.8

  • IPTG concentration: 0.5 mmol/L

  • Induction temperature: 25-30°C (lower than growth temperature) to enhance proper folding

  • Induction time: 4-6 hours

For membrane proteins like nuoK, addition of glucose has been shown to significantly enhance expression efficiency through rapid uptake and metabolism by bacteria, which facilitates more efficient energy conversion .

What purification strategies are most effective for recombinant nuoK protein?

Purification of recombinant nuoK requires specialized approaches due to its membrane-embedded nature:

• Cell lysis protocol:

  • Mechanical disruption (sonication or French press) in buffer containing protease inhibitors

  • Membrane fraction isolation through differential centrifugation (low-speed centrifugation to remove debris, followed by high-speed ultracentrifugation to collect membranes)

• Solubilization strategy:

  • Use mild detergents (n-dodecyl-β-D-maltoside or LDAO) at concentrations above CMC

  • Solubilization buffer should contain stabilizing agents (glycerol 10%, NaCl 150-300 mM)

  • Incubation at 4°C with gentle rotation for 1-2 hours

• Affinity purification:

  • For His-tagged nuoK (as in the described construct), immobilized metal affinity chromatography (IMAC)

  • Wash buffers containing low concentrations of imidazole (20-40 mM) and detergent

  • Elution with 250-500 mM imidazole gradient

• Post-purification handling:

  • Buffer exchange to remove imidazole

  • Storage in buffer containing 50% glycerol at -20/-80°C to avoid freeze-thaw cycles

  • Lyophilization may be performed for long-term storage

When working with fusion proteins like MBP-nuoK, consider the possibility of on-column cleavage of the fusion tag if required for downstream applications.

How can researchers verify the structural integrity and functionality of purified recombinant nuoK?

Verification of structural integrity and functionality of purified recombinant nuoK involves multiple complementary approaches:

• Structural integrity assessment:

  • SDS-PAGE for purity and expected molecular weight confirmation

  • Circular dichroism (CD) spectroscopy to assess secondary structure composition, particularly alpha-helical content expected in membrane proteins

  • Limited proteolysis to evaluate folding quality (properly folded proteins show resistance to proteolytic digestion at specific sites)

• Functional analyses:

  • Reconstitution into liposomes or nanodiscs to measure proton translocation activity

  • NADH:ubiquinone oxidoreductase activity assays when assembled with other complex subunits

  • Membrane potential measurements in reconstituted systems

• Interaction studies:

  • Pull-down assays to verify interactions with other complex subunits

  • Cross-linking experiments to map proximity to neighboring subunits

  • Blue native PAGE to assess incorporation into the complete complex

• Thermal stability assessment:

  • Differential scanning fluorimetry to determine protein stability under various conditions

  • Testing stability in different detergents and buffer compositions

For functional studies, comparison with wild-type and known mutant forms of the protein can provide valuable benchmarks for activity levels.

How do mutations in nuoK affect H. pylori antimicrobial resistance, particularly to benzimidazole derivatives?

While direct mutations in nuoK have not been specifically documented in the provided search results, the nuo operon, which includes nuoK, has been implicated in benzimidazole resistance. Mutations in other subunits of the complex, particularly nuoD (G398S, F404S, and V407M) and nuoB (T27A), confer resistance to benzimidazole derivatives . These findings suggest that:

• The entire NADH:ubiquinone oxidoreductase complex likely serves as the cellular target for benzimidazole derivatives in H. pylori.

• Although specific mutations in nuoK have not been identified, its physical and functional association with nuoD and nuoB suggests potential involvement in resistance mechanisms.

• The mechanism likely involves alterations in the conformational structure of the complex or changes in the electron transport pathway, reducing drug binding or efficacy.

• Researchers investigating nuoK should consider its role within the context of the entire complex, as mutations in one subunit can affect the function of others.

To study nuoK's role in antimicrobial resistance, researchers should employ site-directed mutagenesis to introduce specific mutations and assess the resulting changes in benzimidazole susceptibility. Complementation studies with wild-type nuoK in resistant strains can help elucidate its specific contribution to resistance mechanisms.

What is the relationship between nuoK function and H. pylori pathogenesis?

The relationship between nuoK function and H. pylori pathogenesis is multifaceted:

• Energy metabolism and colonization: As part of the NADH:ubiquinone oxidoreductase complex, nuoK contributes to energy production, which is critical for successful colonization of the gastric mucosa. Impaired energy metabolism could reduce bacterial fitness in the challenging gastric environment.

• Adaptation to microaerophilic conditions: H. pylori thrives in microaerophilic conditions, and the respiratory chain, including nuoK, plays a crucial role in adapting to these conditions within the gastric mucosa. This adaptation is fundamental to establishing persistent infection.

• Persistence during infection: H. pylori infections are notably persistent, with approximately 50% of nonulcer dyspepsia patients showing H. pylori infection and chronic gastritis . The energy metabolism supported by nuoK and other subunits enables long-term colonization.

• Indirect contribution to virulence: While not a direct virulence factor, the functionality of nuoK supports bacterial survival, allowing H. pylori to express and deploy its virulence factors effectively. This indirectly contributes to gastritis, ulcer formation, and the eventual development of gastric cancer in some patients .

• Potential therapeutic target: The involvement of the nuo complex in antimicrobial resistance highlights its importance as a potential therapeutic target. Understanding nuoK's structure and function could help develop new antimicrobials that target this essential component of bacterial metabolism.

Research approaches should include comparative studies of nuoK mutants versus wild-type strains in animal infection models, focusing on colonization efficiency, persistence, and the development of pathological changes.

How does the structure of H. pylori nuoK differ from homologous proteins in other bacterial species?

H. pylori nuoK exhibits several structural and functional distinctions from homologous proteins in other bacterial species:

• Sequence divergence: The amino acid sequence of H. pylori nuoK (MIGLNHYLIVSGLLFCIGLAGMLKRKNILLLFFSTEIMLNAINIGFIAISKYTHNLDGQMFALFIIAIAASEVAIGLGLVILWFKKYKSLDIDSLNAMKG) shows moderate conservation of hydrophobic domains compared to other bacteria, but contains unique regions that likely reflect adaptation to the specific environment of H. pylori.

• Size and transmembrane topology: At 100 amino acids, H. pylori nuoK is relatively compact compared to some homologs. It likely contains three transmembrane helices based on hydrophobicity analysis, though this may vary slightly from the typical pattern observed in other bacteria.

• Species-specific interactions: The protein interfaces between nuoK and other subunits in H. pylori may differ from those in other species, reflecting co-evolution of the entire complex. These unique interfaces could explain species-specific responses to inhibitors.

• Functional adaptations: H. pylori's adaptation to the acidic gastric environment may be reflected in subtle structural modifications of nuoK that optimize complex function under these conditions.

• Potential unique binding sites: The involvement of the nuo complex in benzimidazole resistance suggests that H. pylori nuoK and associated subunits may contain unique binding pockets or structural elements not present in other bacterial homologs.

Comparative structural biology approaches, including homology modeling based on resolved structures from other bacteria, coupled with experimental validation through mutagenesis studies, would help elucidate these differences more precisely.

What strategies can overcome the low yield issues often encountered when expressing membrane proteins like nuoK?

Low yield is a common challenge when expressing membrane proteins like nuoK. Several strategies can address this issue:

• Optimization of expression systems:

  • Consider using specialized E. coli strains (C41(DE3), C43(DE3)) engineered for membrane protein expression

  • Evaluate alternative expression hosts such as Lactococcus lactis or cell-free systems

  • Test fusion partners beyond His-tag, such as MBP, which can enhance solubility and expression

• Culture media optimization:

  • Implement statistical design of experiments (DOE) using response surface methodology (RSM) and artificial neural network (ANN) approaches to identify optimal media composition

  • Supplement with glucose as the carbon source which has been shown to enhance expression through efficient energy conversion

  • Add inorganic nitrogen sources (NH₄Cl) alongside organic sources (yeast extract) for improved growth dynamics

  • Include Ca²⁺ which can affect ribosome function and protein folding

• Induction strategy refinement:

  • Reduce induction temperature (16-25°C) to slow protein production and improve folding

  • Lower IPTG concentration (0.1-0.2 mM) for gentler induction

  • Extend induction time (overnight or longer) at lower temperatures

  • Consider auto-induction media for gradual, stress-reduced protein expression

• Co-expression approaches:

  • Co-express with chaperones (GroEL/ES, DnaK/J) to assist proper folding

  • Consider co-expressing with other subunits of the complex that interact directly with nuoK

Quantitative comparison showed that ANN-linked genetic algorithm (ANN-GA) models exhibited superior predictive accuracy for optimizing recombinant protein production, achieving yields up to 93.2% higher than initial conditions for other H. pylori recombinant proteins . Similar approaches could be applied to nuoK expression.

How can researchers address protein aggregation issues during purification of recombinant nuoK?

Protein aggregation is a significant challenge when purifying membrane proteins like nuoK. The following strategies can help mitigate this issue:

• Detergent optimization:

  • Screen multiple detergents systematically (DDM, LDAO, Triton X-100, CHAPS)

  • Test detergent mixtures which sometimes provide superior solubilization

  • Consider newer amphipathic agents like SMA copolymers that extract proteins with surrounding lipids as nanodiscs

• Buffer composition refinement:

  • Add stabilizing agents: glycerol (10-20%), specific lipids, cholesterol hemisuccinate

  • Optimize salt concentration (typically 150-300 mM NaCl)

  • Test different pH conditions to find optimal stability range

  • Include reducing agents (DTT, TCEP) if disulfide-mediated aggregation occurs

• Handling techniques:

  • Maintain samples at 4°C throughout purification

  • Minimize concentration steps and mechanical stress

  • Use gentle mixing methods (avoid vortexing)

  • Consider on-column detergent exchange during purification

• Aggregation monitoring and intervention:

  • Implement dynamic light scattering (DLS) to detect early aggregation

  • Use size exclusion chromatography as both analytical tool and purification step

  • Apply thermal stability assays to identify stabilizing conditions

• Alternative approaches:

  • Consider native-like extraction using styrene-maleic acid lipid particles (SMALPs)

  • Explore nanodiscs or amphipols for detergent-free handling post-purification

  • For severe aggregation, re-solubilization from inclusion bodies using mild denaturing conditions followed by refolding may be necessary

A systematic approach documenting protein behavior under various conditions in a detergent/buffer matrix can help identify optimal conditions for maintaining nuoK in a native-like, non-aggregated state.

What are the key considerations when designing site-directed mutagenesis experiments for nuoK functional studies?

Designing effective site-directed mutagenesis experiments for nuoK requires careful planning:

• Target selection based on structural prediction:

  • Focus on conserved residues identified through multiple sequence alignment

  • Target charged residues within putative proton channels

  • Consider transmembrane domains and potential lipid-interacting regions

  • Examine interface regions with other subunits based on neighboring structures in the nuo complex

  • Use insights from mutations identified in related subunits (like the G398S, F404S, and V407M in nuoD and T27A in nuoB that affect benzimidazole resistance)

• Mutation design strategy:

  • Conservative substitutions (similar properties) to probe subtle functional changes

  • Non-conservative substitutions to test essential nature of residues

  • Alanine scanning for systematic functional mapping

  • Introduction of reporter groups (cysteine for labeling, tryptophan for fluorescence)

• Expression and functional validation:

  • Verify protein expression and membrane incorporation of mutants

  • Assess stability changes using thermal shift assays

  • Measure proton translocation in reconstituted systems

  • Test electron transfer rates within the complex

  • Evaluate antimicrobial susceptibility profiles of mutants

• Controls and experimental design:

  • Always include wild-type controls processed identically

  • Create multiple mutations of the same residue (conservative and drastic)

  • Design mutation series (e.g., along predicted proton pathway)

  • Consider double mutations to identify compensatory effects

• Interpretation frameworks:

  • Develop clear hypotheses about expected outcomes before experimentation

  • Establish quantitative parameters for functional assessment

  • Consider structural modeling to interpret results in spatial context

  • Map findings onto known mechanisms from better-characterized homologs

When examining antimicrobial resistance, focus on regions analogous to those identified in nuoD and nuoB that confer benzimidazole resistance, as similar structural elements might exist in nuoK .

How might structural studies of nuoK contribute to novel antimicrobial development against H. pylori?

Structural studies of nuoK could significantly advance antimicrobial development through several avenues:

• Target identification and validation:

  • High-resolution structures would reveal potential binding pockets unique to H. pylori nuoK

  • Mapping differences between human mitochondrial Complex I and bacterial nuoK would highlight targeting opportunities with minimal host toxicity

  • Structural insights would help understand the mechanism behind benzimidazole resistance mutations in the nuo complex

• Structure-based drug design approaches:

  • Crystal or cryo-EM structures could enable virtual screening campaigns against nuoK or its interfaces

  • Fragment-based approaches might identify initial chemical matter targeting critical functional sites

  • Understanding the conformational dynamics of nuoK during the catalytic cycle could reveal transient pockets for inhibitor binding

• Resistance mechanism elucidation:

  • Structural comparison between wild-type and resistant forms (from mutants like those in nuoD: G398S, F404S, and V407M) would show how resistance emerges at the molecular level

  • This could guide design of next-generation antimicrobials less susceptible to resistance development

• Allosteric inhibitor development:

  • Structures might reveal allosteric sites distinct from the catalytic regions

  • These sites could offer opportunities for selective inhibition without affecting the highly conserved active sites

• Combination therapy foundations:

  • Structural understanding of nuoK inhibition could inform rational combinations with existing therapies

  • This approach might address the high rates of treatment failure and emerging resistance in H. pylori infections

These structural insights would be particularly valuable given the increasing prevalence of antibiotic-resistant H. pylori strains and the association between H. pylori infection and both peptic ulcer disease and gastric cancer .

What are the cutting-edge approaches for studying protein-protein interactions between nuoK and other subunits of the NADH-quinone oxidoreductase complex?

Several cutting-edge approaches can elucidate protein-protein interactions within the NADH-quinone oxidoreductase complex:

• Cryo-electron microscopy (cryo-EM):

  • Single-particle cryo-EM can resolve the entire complex structure at near-atomic resolution

  • Subtomogram averaging can capture different conformational states during the catalytic cycle

  • This approach has revolutionized membrane protein complex structural biology, particularly for large assemblies like respiratory complexes

• Cross-linking mass spectrometry (XL-MS):

  • Chemical cross-linkers with various spacer lengths can capture spatial relationships between subunits

  • Photo-activatable cross-linkers offer precise control over the cross-linking reaction

  • Mass spectrometry identifies cross-linked peptides, providing distance constraints for modeling interfaces

• Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

  • Maps solvent accessibility changes upon complex formation

  • Identifies protected regions at protein-protein interfaces

  • Reveals conformational changes induced by subunit interactions

• Integrative structural biology approaches:

  • Combines multiple experimental data types (cryo-EM, XL-MS, HDX-MS)

  • Utilizes computational modeling to generate composite structural models

  • Particularly powerful for dynamic complexes with flexible regions

• Single-molecule FRET (smFRET):

  • Site-specific labeling of nuoK and interacting partners

  • Real-time observation of dynamic interactions

  • Captures transient states missed by ensemble methods

• Native mass spectrometry:

  • Preserves intact complexes and subcomplexes

  • Provides stoichiometry information

  • Can detect small molecules or lipids involved in complex stability

These approaches could reveal how mutations in nuoD (G398S, F404S, and V407M) and nuoB (T27A) affect interactions with nuoK and other subunits, thereby explaining the molecular basis of benzimidazole resistance in H. pylori .

How can systems biology approaches integrate nuoK function with broader H. pylori metabolism and pathogenesis models?

Systems biology offers powerful frameworks to integrate nuoK function into comprehensive models of H. pylori metabolism and pathogenesis:

These integrated approaches could help address the complex challenge of H. pylori infections, which affect approximately 50% of patients with nonulcer dyspepsia and contribute to chronic gastritis, potentially leading to ulcers and gastric cancer . Understanding nuoK within this broader context could reveal new therapeutic strategies targeting this persistent pathogen.