Recombinant Helicobacter pylori Protease HtpX homolog (htpX)

Shipped with Ice Packs
In Stock

Description

Recombinant HtpX Homolog in Geobacter uraniireducens

The HtpX homolog from Geobacter uraniireducens is a recombinant protein with the following properties:

HtrA Protease in Helicobacter pylori

While HtpX is absent in H. pylori, the HtrA protease (a functionally analogous serine protease) is critical for bacterial survival and pathogenesis. Key findings include:

Biochemical Properties

PropertyDetails
Optimal pH6.0–8.0
Thermal StabilityRetains activity up to 60°C
InhibitorsSmall-molecule inhibitors (e.g., HHI) block E-cadherin cleavage

Comparative Analysis of HtpX and HtrA Homologs

FeatureHtpX (G. uraniireducens) HtrA (H. pylori)
OrganismGeobacter uraniireducensHelicobacter pylori
FunctionProtease (uncharacterized in host)Virulence factor, E-cadherin cleavage
StructureMonomeric (His-tagged)Trimeric (N-terminal domain-swapped)
Therapeutic TargetNot reportedDrug target for gastric cancer prevention

Research Gaps and Implications

  • HtpX in H. pylori: No direct evidence exists for an HtpX homolog in H. pylori within the provided sources. The primary protease studied is HtrA.

  • HtrA as a Drug Target: Inhibitors like HHI block HtrA’s proteolytic activity, suggesting therapeutic potential .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
htpX; HPSH_04885; Protease HtpX homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-310
Protein Length
full length protein
Species
Helicobacter pylori (strain Shi470)
Target Names
htpX
Target Protein Sequence
MTNFEKIIAQNKLKTNAVLATYCVIFAFIGLLVDVIRINANDLGTALFKLMTFQIFPTIT IIMFLVAFVIIVVCIQNFSSIMLSGDEYKLIDKSKVLSSKENQIHRLLLELLEEAKLHFE PKLYIIKAPYMNAFASGWNESNSLIALTSALIERLDRDELKAVIAHELSHIRHNDIRLTM CVGILSNIMLLVANFSVYFFMGNRKNSGANLARMILLVLQIILPFLTLLLQMYLSRTREY MADSGAAFLMHDNKPMIRALQKISNDYANNDYKGVDQNSTRSAAYLFSAEMFSTHPSIKN RIQSLSRRVI
Uniprot No.

Target Background

Database Links
Protein Families
Peptidase M48B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the HtpX protease and what is its significance in Helicobacter pylori?

HtpX is a membrane-bound zinc metalloproteinase belonging to the M48 family of proteases. While extensively studied in Escherichia coli, its homolog in H. pylori shares similar structural and functional characteristics. In bacterial systems, HtpX is involved in the quality control of membrane proteins, eliminating malfolded or misassembled proteins that could compromise membrane integrity and cellular function . In H. pylori, which is a significant human pathogen associated with gastritis, peptic ulcer disease, and gastric cancer, membrane proteases play important roles in bacterial survival and pathogenesis .

How does HtpX differ from other H. pylori proteases such as HtrA?

While both are proteases, HtpX and HtrA represent different protease families with distinct catalytic mechanisms:

FeatureHtpXHtrA
Protease familyM48 zinc metalloproteinaseSerine protease
Catalytic siteZinc-coordinating motifSerine residue (S221 in H. pylori)
LocationIntegral membrane proteinPeriplasmic with secreted fraction
FunctionQuality control of membrane proteinsDisrupts gastric epithelium; processes exported proteins
Essential geneVariable across strainsEssential in most H. pylori strains tested
MutagenesisGenerally achievableDifficult (achieved only in N6 strain with SecA mutations)

HtrA in H. pylori has been more extensively studied and is known to be secreted, enabling the bacterium to disrupt tight junctions in the gastric epithelium, facilitating bacterial transmigration and CagA protein injection into host cells . HtpX, on the other hand, primarily functions within the bacterial membrane system.

What expression systems are commonly used for recombinant production of H. pylori HtpX?

The recombinant expression of H. pylori HtpX can be achieved through several systems:

  • E. coli expression systems: BL21(DE3) strains have been used for initial cloning and expression optimization .

  • Bacillus subtilis WB800N: This system has been employed for high-level expression, using the pHT43 vector with IPTG induction .

  • Complementation systems: Similar to approaches used for HtrA, genetic complementation systems can be established to study functionality .

The choice of expression system depends on research objectives, with E. coli systems typically used for structural and biochemical studies, while complementation in H. pylori or related organisms may be more suitable for functional analyses.

How can I clone and express the htpX gene from H. pylori for recombinant protein production?

A methodological approach for cloning and expressing H. pylori htpX involves:

  • Gene amplification: Design primers containing appropriate restriction sites (such as BamHI and SmaI) based on the htpX gene sequence from H. pylori genome data .

  • Vector construction:

    • PCR amplify the htpX gene from H. pylori genomic DNA

    • Digest the amplified product and expression vector (e.g., pHT43) with appropriate restriction enzymes

    • Ligate the digested products and transform into E. coli DH5α for plasmid propagation

  • Expression host transformation:

    • Transform the validated recombinant plasmid into an expression host such as E. coli BL21(DE3)

    • For higher expression efficiency, consider Bacillus subtilis WB800N, which requires electroporation

  • Protein expression induction:

    • Culture transformants to mid-logarithmic phase (OD600 ≈ 0.6-0.8)

    • Induce protein expression with IPTG (typically 1 mM final concentration)

    • Harvest cells by centrifugation for protein purification

The recombinant DX-3-htpX protease has demonstrated a remarkable 61.9-fold increase in fermentation level compared to the native DX-3 protease, indicating the effectiveness of recombinant expression strategies .

What are the optimal conditions for assessing proteolytic activity of recombinant HtpX?

Based on methodologies developed for similar bacterial proteases, the following approaches can be used to assess HtpX activity:

  • Model substrate selection:

    • For membrane proteases like HtpX, establishing appropriate model substrates is crucial

    • An in vivo semi-quantitative assay system using engineered substrate proteins can effectively measure proteolytic activity

    • Consider substrates similar to those used for HtrA, such as β-casein (naturally unstructured) and chemically denatured lysozyme

  • Activity assay conditions:

    • Optimize buffer conditions (pH, salt concentration)

    • Include appropriate metal cofactors (zinc is essential for metalloproteinases)

    • Control temperature conditions relevant to H. pylori physiology (37°C is standard, with 39°C used to assess stress responses)

  • Detection methods:

    • SDS-PAGE analysis of substrate degradation

    • Western blotting to detect specific cleavage fragments

    • Fluorescence-based assays if using tagged substrates

How can site-directed mutagenesis be used to investigate HtpX functionality?

Site-directed mutagenesis is a powerful approach to investigate structure-function relationships in proteases:

  • Target selection:

    • Identify conserved residues in HtpX by sequence alignment with homologs

    • Focus on putative catalytic residues and zinc-coordinating motifs

    • Consider residues at the substrate binding pocket

  • Mutagenesis strategy:

    • Design primers containing the desired mutations

    • Use PCR-based methods (QuikChange or overlap extension PCR)

    • Confirm mutations by sequencing

  • Functional analysis:

    • Compare proteolytic activity of wild-type and mutant proteins

    • Assess protein stability and folding

    • Evaluate the impact on bacterial growth under various stress conditions

This approach has been effectively demonstrated with the HtrA protease where S221A mutation resulted in proteolytically inactive enzyme variants that retained proper folding .

What is the relationship between HtpX and the Sec translocon apparatus in H. pylori?

Recent research on bacterial proteases suggests important functional relationships between membrane proteases and protein translocation machinery:

  • The Sec translocon is responsible for translocating proteins from the cytoplasm into the periplasm in Gram-negative bacteria .

  • In H. pylori, mutations in the SecA component of the Sec translocon have been observed in strains where the HtrA protease was successfully inactivated, suggesting a compensatory relationship .

  • Similar co-localization and functional cooperation between HtrA and SecA has been reported in Streptococcus pneumoniae, indicating a conserved mechanism .

  • For HtpX, which functions in membrane protein quality control, a similar relationship with the Sec translocon may exist, as both systems deal with membrane and periplasmic protein homeostasis.

  • Investigation of potential interactions between HtpX and SecA in H. pylori could reveal important insights into bacterial periplasmic homeostasis mechanisms that may be conserved across species .

Research into this relationship would require co-localization studies, protein-protein interaction analyses, and genetic studies examining the effects of mutations in both systems.

How does environmental stress affect HtpX expression and activity in H. pylori?

Understanding stress responses is crucial for comprehending H. pylori adaptation mechanisms:

  • pH stress: H. pylori must survive the acidic environment of the stomach. Studies with HtrA have shown differential growth patterns of wild-type and mutant strains under varied pH conditions . Similar investigations with HtpX would provide insights into its role in acid adaptation.

  • Osmotic stress: H. pylori encounters osmotic challenges in the gastric environment. Testing growth in the presence of osmolytes like sucrose, NaCl, or MgCl₂ at different temperatures (37°C and 39°C) can reveal HtpX's role in osmotic stress responses .

  • Temperature stress: HtpX (High Temperature Requirement X) naming suggests temperature-dependent functions. Comparing growth and proteolytic activity at normal (37°C) versus elevated temperatures (39-42°C) can elucidate its role in heat shock response.

  • Oxidative stress: The inflammatory response to H. pylori infection creates oxidative stress. Examining HtpX expression and activity under hydrogen peroxide or other oxidative agents could reveal protective functions.

Experimental designs should include comparison of wild-type, htpX deletion mutants, and complemented strains to accurately assess HtpX's specific contributions to stress tolerance.

What role might HtpX play in H. pylori pathogenesis and host interaction?

While direct evidence for HtpX's role in H. pylori pathogenesis is limited, several research directions could explore this relationship:

  • Membrane protein quality control: HtpX's function in maintaining membrane proteostasis likely impacts bacterial fitness in the host environment. Experiments comparing colonization efficiency between wild-type and htpX mutants in animal models would be informative.

  • Virulence factor processing: Similar to HtrA's role in processing secreted proteins, HtpX might be involved in processing membrane-associated virulence factors. Proteomic analysis comparing the membrane protein profiles of wild-type and htpX mutant strains could identify potential substrates.

  • Antibiotic resistance: Membrane proteases can affect bacterial susceptibility to antibiotics, particularly those targeting cell envelope. Measuring minimum inhibitory concentrations (MICs) of various antibiotics against htpX mutants could reveal roles in antimicrobial resistance.

  • Biofilm formation: H. pylori forms biofilms that contribute to persistence and antibiotic tolerance. Assessing biofilm formation capacity of htpX mutants could reveal roles in this important survival strategy.

Importantly, these investigations should carefully distinguish between direct effects of HtpX activity and indirect consequences of altered membrane homeostasis.

Could HtpX serve as a diagnostic marker for H. pylori infection?

While H. pylori diagnostic methods are well-established, the potential of HtpX as a diagnostic marker warrants investigation:

How might understanding HtpX function contribute to therapeutic strategies against H. pylori?

Research into bacterial proteases has significant implications for antimicrobial development:

  • Protease inhibitors: If HtpX proves essential for H. pylori survival or virulence, specific inhibitors could be developed as potential therapeutics. This approach requires:

    • High-throughput screening assays for inhibitor discovery

    • Structure-based drug design utilizing solved or modeled HtpX structures

    • Medicinal chemistry optimization of lead compounds

    • Evaluation in cellular and animal models

  • Combinatorial approaches: Given increasing antibiotic resistance in H. pylori, combining conventional antibiotics with protease inhibitors might enhance treatment efficacy. This strategy requires testing various combinations and concentrations to identify synergistic effects.

  • Strain-specific considerations: Given the variability observed in essentiality of proteases across H. pylori strains (as seen with HtrA) , therapeutic strategies targeting HtpX would need to account for potential strain-specific differences.

  • Vaccine development: If HtpX proves sufficiently immunogenic and surface-exposed, it might serve as a component in multi-antigen vaccine formulations against H. pylori.

What challenges might be encountered when generating htpX knockout mutants in H. pylori?

Creating gene knockouts in H. pylori presents specific challenges:

  • Gene essentiality: Some genes, like htrA in most H. pylori strains, cannot be directly inactivated due to their essential nature . Initial attempts to generate htpX knockouts should use multiple strains, as essentiality can be strain-dependent.

  • Suppressor mutations: When attempting to knockout essential genes, suppressor mutations may arise that compensate for the loss. Complete genome sequencing of successful mutants is recommended to identify such mutations, as was done with htrA knockouts where SecA mutations were discovered .

  • Complementation systems: Establishing complementation systems before knockout attempts can help verify gene function and potentially facilitate isolation of conditional mutants. Examples include:

    • Chromosomal integration of an inducible second copy

    • Complementation in related bacterial species

    • Expression of catalytically inactive variants

  • Alternative approaches: If direct knockouts prove impossible, consider:

    • Conditional knockdowns using antisense RNA

    • CRISPR interference (CRISPRi) for gene silencing

    • Temperature-sensitive alleles

    • Controlled proteolytic degradation systems

How can I address solubility issues when purifying recombinant HtpX?

Membrane proteases like HtpX present significant purification challenges:

  • Expression optimization:

    • Test different expression vectors, promoters, and host strains

    • Optimize induction conditions (temperature, inducer concentration, duration)

    • Consider fusion tags that enhance solubility (MBP, SUMO, TrxA)

    • Evaluate periplasmic targeting versus cytoplasmic expression

  • Membrane protein extraction:

    • Screen detergents systematically (DDM, LDAO, Triton X-100)

    • Use mild solubilization conditions to maintain native structure

    • Consider nanodiscs or other membrane mimetics for stabilization

    • Implement two-phase extraction systems for membrane proteins

  • Purification strategy:

    • Employ affinity chromatography with His-tags or other fusion tags

    • Include protease inhibitors to prevent autodegradation

    • Maintain detergent above critical micelle concentration throughout purification

    • Consider on-column refolding for inclusion body preparations

  • Quality assessment:

    • Verify correct folding through activity assays

    • Assess oligomeric state using size exclusion chromatography

    • Confirm protein identity with mass spectrometry

    • Evaluate thermal stability using differential scanning fluorimetry

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.