Recombinant Helicobacter pylori Protein-export membrane protein SecG (secG)

Shipped with Ice Packs
In Stock

Description

Role in H. pylori Protein Export

SecG operates within the Sec translocon alongside SecY and SecE. Key findings include:

  • Post-Translational Translocation: SecA ATPase drives the translocation of periplasmic and outer membrane proteins through the SecYEG channel .

  • Mutational Studies: In H. pylori, disruptions in SecA (a translocon-associated ATPase) are linked to compensatory mutations, suggesting functional interplay between SecA and SecG .

Diagnostic Development

  • ELISA Kits: Recombinant SecG is used in ELISA for detecting H. pylori antibodies (e.g., CBM15’s kit, Catalog: CSB-CF521360HUV) .

  • Seroreactivity: Similar to recombinant UreG (another H. pylori antigen), SecG shows potential for diagnostic assays, though validation studies are pending .

Mechanistic Studies

  • Protein-Protein Interactions: Used to map interactions within the Sec translocon or with virulence factors like CagL (a Type IV secretion system protein) .

  • Membrane Dynamics: Investigates conformational changes during substrate translocation .

Comparative Analysis with Other H. pylori Recombinant Proteins

ProteinFunctionRecombinant UseKey References
SecGProtein export membrane componentStructural/functional studies, diagnostics
CagLT4SS pilus assembly, integrin bindingHost-pathogen interaction studies
UreGNickel metallochaperone for ureaseDiagnostic antigen, vaccine candidate
HtrASerine protease, E-cadherin cleavageVirulence and pathogenesis studies

Challenges and Future Directions

  • Functional Redundancy: SecG’s role may overlap with other translocon components, complicating knockout studies .

  • Therapeutic Targeting: SecG inhibitors could disrupt protein export, but specificity remains a challenge due to homology with human proteins.

  • Diagnostic Potential: Requires clinical validation to assess sensitivity/specificity compared to established antigens like UreG .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
secG; HP_1255; Protein-export membrane protein SecG
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-199
Protein Length
full length protein
Species
Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)
Target Names
secG
Target Protein Sequence
MTSALLGLQIVLAVLIVVVVLLQKSSSIGLGAYSGSNESLFGAKGPASFMAKLTMFLGLL FVINTIALGYFYNKEYGKSVLDETKTNKELSPLVPATGTLNPALNPTLNPTLNPLEQAPT NPLMPQQTPNELPKEPAKTPSVESPKQNEKNEKNDAKENGIKGVEKTKENAKTPPTTHQK PKTHATQTNAHTNQKKDEK
Uniprot No.

Target Background

Function

SecG is involved in protein export and participates in an early stage of protein translocation.

Database Links
Protein Families
SecG family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the role of SecG protein in Helicobacter pylori physiology?

SecG is a critical component of the bacterial protein export machinery in H. pylori. It functions as part of the Sec translocase system, which facilitates the translocation of proteins across the cytoplasmic membrane. In H. pylori, SecG contributes to the secretion of virulence factors, including the vacuolar toxin (VacA), which plays a significant role in H. pylori pathogenesis . The SecG protein is exclusively found in bacteria and not in eukaryotic cells, making it an attractive target for antimicrobial development.

The protein is composed of 199 amino acids with a molecular weight of approximately 25 kDa. According to genomic comparisons, SecG is part of the core proteome shared between different H. pylori strains, suggesting its essential role in bacterial survival .

What expression systems are commonly used for recombinant H. pylori SecG protein production?

The most widely used expression system for recombinant H. pylori SecG is Escherichia coli BL21(DE3), particularly with pET expression vectors. This system provides several advantages:

  • High expression levels due to the strong T7 promoter

  • Protease deficiency in BL21(DE3) strains, enhancing protein stability

  • Compatibility with various affinity tags for purification

  • Cost-effectiveness and rapid growth

Based on similar recombinant H. pylori protein production methods, recombinant SecG has been expressed using vectors like pET21b and pET28a(+) . For example, in comparable studies with H. pylori UreG, the recombinant protein was expressed with a His-tag for subsequent purification using nickel affinity chromatography .

Alternative expression systems that may be considered include:

  • Yeast

  • Baculovirus

  • Mammalian cell systems

What purification methods are effective for recombinant H. pylori SecG?

Based on established methodologies for similar H. pylori recombinant proteins, the following purification protocol is recommended:

  • Affinity chromatography using Ni-NTA resin (for His-tagged SecG)

  • Buffer optimization (typically Tris-based buffer with 50% glycerol)

  • SDS-PAGE and Western blotting for verification of purity and identity

For example, in studies with other H. pylori recombinant proteins like CagA and UreG, researchers successfully purified proteins using Ni-NTA columns with yields of 1.4-3 mg/L of culture . Purification efficiency can be verified through SDS-PAGE, which should reveal a band at approximately 25 kDa for SecG.

How does the expression of soluble versus insoluble recombinant SecG affect experimental outcomes?

The solubility of recombinant SecG significantly impacts experimental applications and requires careful optimization. According to studies on similar membrane proteins from H. pylori, the following factors influence solubility:

  • Expression temperature: Lower temperatures (16-20°C) often increase soluble protein yield

  • Induction conditions: IPTG concentration and induction timing are critical

  • Fusion partners: Solubility-enhancing tags (e.g., GST, MBP) can improve soluble expression

Comparative data from related H. pylori recombinant protein studies show:

ProteinSoluble fraction yieldInsoluble fraction yieldExpression conditions
UreG1.4 mg/L3 mg/L37°C, 1 mM IPTG, 4h induction
SecA N-terminal domainVariable based on conditionsPredominant formOptimized at 25°C, 0.5 mM IPTG

What are the structural characteristics of H. pylori SecG and how do they impact functional studies?

The computed structure model of H. pylori SecG (strain J99/ATCC 700824) reveals several important features:

  • Transmembrane domains: SecG likely contains multiple transmembrane segments

  • Confidence metrics: The protein has a pLDDT (predicted Local Distance Difference Test) global score of 59.01, indicating medium confidence in the structural prediction

  • Regions of varying confidence: Some regions have higher structural confidence (pLDDT > 70) while others have lower confidence (pLDDT ≤ 50)

For functional studies, consideration of these structural characteristics is essential:

  • Detergent selection: Appropriate detergents must be selected for solubilization while maintaining native conformation

  • Buffer composition: Lipid composition and ionic strength significantly affect SecG stability and function

  • Interaction studies: Knowledge of high-confidence structural regions should guide the design of protein-protein interaction experiments

The amino acid sequence (MTSALLGLQIVLAVLIVVVVLLQKSSSIGLGAYSGSNESLFGAKGPASFMAKLTMFLGLLFVINTIALGYFYNKEYGKSVLDETKTNKELSPLVPATGTLNPALNPTLNPTLNPLEQAPTNPLMPQQTPNELPKEPAKTPSVESPKQNEKNEKNDAKENGIKGVEKTKENAKTPPTTHQKPKTHATQTNAHTNQKKDEK) reveals hydrophobic regions typical of membrane proteins .

How can researchers effectively design experiments to study the interaction between SecG and other components of the H. pylori Sec translocase?

Designing robust experiments to study SecG interactions requires multiple complementary approaches:

  • In vitro reconstitution systems:

    • Purify recombinant SecG, SecY, SecE, and SecA

    • Reconstitute in proteoliposomes of defined composition

    • Measure protein translocation efficiency using radiolabeled substrates

  • Crosslinking approaches:

    • Use bifunctional crosslinkers with varying spacer lengths

    • Perform site-directed mutagenesis to introduce cysteine residues at predicted interaction sites

    • Analyze crosslinked products by mass spectrometry

  • Fluorescence-based interaction assays:

    • Label SecG and potential interaction partners with FRET pairs

    • Monitor dynamic interactions in real-time

    • Quantify binding affinities and kinetics

  • Co-immunoprecipitation and pull-down assays:

    • Express tagged versions of SecG in H. pylori

    • Identify interaction partners by mass spectrometry

    • Validate interactions using recombinant proteins

These approaches should include appropriate controls, such as SecG mutants with altered functionality, to establish specificity of interactions.

What methodologies can be employed to assess the role of SecG in H. pylori pathogenesis using recombinant protein?

To investigate SecG's role in pathogenesis, researchers can employ several methodologies:

  • Adhesion assays with gastric epithelial cells:

    • Use purified recombinant SecG to compete with H. pylori adhesion to AGS cells

    • Assess whether SecG directly or indirectly affects bacterial attachment

    • Quantify using confocal microscopy and fluorescently labeled bacteria

  • Inhibition studies:

    • Develop inhibitors targeting SecG based on structural information

    • Test effects on H. pylori protein secretion, particularly of virulence factors

    • Measure impact on bacterial survival and pathogenesis markers

  • Immunogenicity assessment:

    • Evaluate human sera from H. pylori-infected patients for anti-SecG antibodies

    • Develop western blot or ELISA assays using recombinant SecG as antigen

    • Compare reactivity patterns between patients with different clinical manifestations

  • Animal infection models:

    • Immunize animal models with recombinant SecG

    • Challenge with H. pylori infection

    • Assess protection and immune responses

For example, studies with other H. pylori recombinant proteins like UreG demonstrated 70% reactivity with IgG and 60% with IgA from infected patients' sera, suggesting strong immunogenicity .

How can expression conditions be optimized to increase yield and solubility of recombinant H. pylori SecG?

Systematic optimization of expression conditions is essential for maximizing SecG yield and solubility:

  • Strain selection:

    • Compare expression in different E. coli strains (BL21, Rosetta, Origami)

    • Test strains with additional chaperones (e.g., Arctic Express)

    • Evaluate codon-optimized constructs for H. pylori-specific codon usage

  • Growth and induction parameters:

    • Temperature: Test 16°C, 25°C, 30°C, and 37°C

    • Media composition: Compare LB, TB, and auto-induction media

    • Inducer concentration: Evaluate IPTG at 0.1, 0.5, and 1.0 mM

    • Induction time: Test 4h, 8h, and overnight induction

  • Construct design:

    • Test different fusion tags (His, GST, MBP, SUMO)

    • Create truncated constructs of hydrophilic domains

    • Insert solubility-enhancing peptides

  • Additive screening:

    • Include osmolytes (glycerol, sorbitol)

    • Test detergents at sub-micellar concentrations

    • Add membrane-mimicking agents (amphipols, nanodiscs)

Document each condition systematically and analyze results by quantifying both soluble and insoluble protein fractions through SDS-PAGE and western blotting.

What analytical techniques are most suitable for characterizing the functionality of recombinant H. pylori SecG?

Multiple analytical techniques can be employed to characterize SecG functionality:

  • ATPase stimulation assays:

    • Measure the ability of SecG to stimulate SecA ATPase activity

    • Monitor ATP hydrolysis using colorimetric assays (malachite green)

    • Compare activity with and without SecYE complex

  • Protein translocation assays:

    • Reconstitute SecG with SecYE in proteoliposomes

    • Use fluorescently labeled pre-proteins as substrates

    • Measure translocation efficiency by protease protection assays

  • Structural characterization:

    • Circular dichroism (CD) spectroscopy to assess secondary structure

    • Limited proteolysis to identify stable domains

    • Thermal shift assays to evaluate protein stability

  • Interaction studies:

    • Surface plasmon resonance (SPR) to measure binding kinetics with SecA and SecYE

    • Isothermal titration calorimetry (ITC) for thermodynamic binding parameters

    • Microscale thermophoresis (MST) for solution-based interaction analysis

For example, similar studies with H. pylori SecA N-terminal domain used malachite green-based assays to measure ATPase activity and determined IC50 values for potential inhibitors .

How can researchers develop reliable immunoassays for H. pylori SecG detection using recombinant protein?

Developing robust immunoassays requires several methodological steps:

  • Production of high-quality antibodies:

    • Immunize animals with purified recombinant SecG

    • Develop both polyclonal and monoclonal antibodies

    • Validate antibody specificity against native H. pylori lysates

  • ELISA development:

    • Optimize coating conditions (buffer, concentration, time)

    • Determine optimal blocking agents to minimize background

    • Establish standard curves using purified recombinant SecG

    • Validate with clinical samples

  • Western blot optimization:

    • Test different transfer conditions for this membrane protein

    • Optimize antibody concentrations and incubation times

    • Develop detection methods (chemiluminescence vs. fluorescence)

  • Validation with clinical samples:

    • Test assay performance with H. pylori-positive and negative samples

    • Determine sensitivity, specificity, and reproducibility

    • Compare with established H. pylori diagnostic methods

Based on studies with other H. pylori antigens, a competitive ELISA format may be particularly effective, with optimal conditions including antibody dilutions of 1:1000, coating antigen concentration of 1 μg/well, HRP-labeled antibody dilution of 1:5000, and color development time of 30 minutes .

How does the structure and function of H. pylori SecG compare to SecG proteins from other bacterial species?

A comparative analysis reveals important similarities and differences:

  • Sequence conservation:

    • SecG proteins typically have low sequence identity across bacterial species

    • Functional residues at interaction interfaces may be more conserved

    • Transmembrane topology is generally preserved despite sequence divergence

  • Functional comparison:

    • Essential role in protein secretion is conserved across species

    • Species-specific differences may exist in substrate specificity

    • Contribution to antibiotic resistance may vary between species

  • Structural differences:

    • H. pylori SecG has unique insertions/deletions compared to E. coli SecG

    • These regions may mediate H. pylori-specific protein interactions

    • Differences in membrane topology could affect inhibitor design

  • Evolutionary implications:

    • SecG is part of the core genome in H. pylori strains

    • Approximately 58% of H. pylori genes have assigned functions based on sequence similarity to proteins with known functions

    • SecG represents conserved protein export machinery essential for bacterial survival

This comparative analysis has implications for developing broad-spectrum vs. H. pylori-specific inhibitors targeting the Sec system.

What is the potential of recombinant H. pylori SecG as a diagnostic marker compared to established H. pylori antigens?

The potential of SecG as a diagnostic marker can be evaluated by comparing it with established antigens:

AntigenSensitivity with IgGSpecificity with IgGComments
CagA70%97.5%Virulence factor associated with increased cancer risk
UreG70%97.5%Involved in urease maturation
HP1564High (comparable to CagA)HighStrong association with NCGC and CGC risk
SecGTo be determinedTo be determinedPotential novel diagnostic marker

To establish SecG's diagnostic potential:

  • Test recombinant SecG reactivity with sera from:

    • Culture-positive H. pylori patients with various clinical manifestations

    • H. pylori-negative individuals

    • Patients with other bacterial infections

  • Compare performance metrics:

    • Sensitivity and specificity

    • Positive and negative predictive values

    • Area under the ROC curve

  • Evaluate potential advantages:

    • Expression during different phases of infection

    • Conservation across H. pylori strains

    • Potential association with specific disease outcomes

Based on studies with other H. pylori antigens, combining multiple markers typically improves diagnostic accuracy, suggesting SecG could be valuable as part of a multi-antigen panel .

How do different expression systems affect the structural integrity and functionality of recombinant H. pylori SecG?

Different expression systems produce recombinant proteins with varying characteristics:

  • E. coli expression systems:

    • Advantages: High yield, rapid growth, cost-effective

    • Limitations: Potential improper folding of membrane proteins, lack of post-translational modifications

    • Optimization: Use of specialized strains (C41/C43) designed for membrane protein expression

  • Yeast expression systems:

    • Advantages: Eukaryotic folding machinery, higher success with membrane proteins

    • Limitations: Lower yields, more complex media requirements

    • Applications: Better for structural studies requiring proper folding

  • Baculovirus expression:

    • Advantages: Near-native folding, suitable for membrane proteins

    • Limitations: More time-consuming, technically challenging

    • Benefits: Potential for higher-quality protein for functional studies

  • Cell-free expression systems:

    • Advantages: Direct incorporation into liposomes or nanodiscs

    • Limitations: Lower yields, higher cost

    • Applications: Ideal for functional studies avoiding detergent solubilization

Researchers should select the expression system based on the intended application, considering factors such as required yield, downstream applications, and budget constraints.

How can recombinant H. pylori SecG be used to develop novel antimicrobial strategies?

Recombinant SecG provides multiple avenues for antimicrobial development:

  • High-throughput inhibitor screening:

    • Develop assays using purified SecG to screen chemical libraries

    • Focus on disrupting SecG-SecA or SecG-SecYE interactions

    • Validate hits in bacterial growth and protein secretion assays

  • Structure-based drug design:

    • Use structural data to identify potential binding pockets

    • Design small molecules targeting critical functional regions

    • Optimize lead compounds for improved specificity and potency

  • Peptide inhibitor development:

    • Design peptides mimicking interaction interfaces

    • Test their ability to disrupt Sec translocase assembly

    • Optimize for stability and cell penetration

  • Vaccine development approaches:

    • Evaluate recombinant SecG as a potential vaccine antigen

    • Test protective efficacy in animal models

    • Assess both humoral and cellular immune responses

Studies with other Sec system components, particularly SecA, have shown that inhibition of this system significantly reduces virulence factor secretion, including VacA toxin, which plays a critical role in H. pylori pathogenesis . This suggests targeting SecG could similarly impair bacterial virulence.

What experimental approaches can determine the topology and membrane insertion mechanism of H. pylori SecG?

Several complementary approaches can elucidate SecG topology and insertion:

  • Cysteine scanning mutagenesis:

    • Introduce single cysteine residues throughout SecG

    • Test accessibility using membrane-permeable and -impermeable sulfhydryl reagents

    • Map topology based on labeling patterns

  • Fluorescence spectroscopy:

    • Introduce environmentally sensitive fluorophores at specific positions

    • Monitor changes in fluorescence upon membrane insertion

    • Determine the kinetics and thermodynamics of insertion

  • Protease protection assays:

    • Express SecG in membrane vesicles

    • Treat with proteases under various conditions

    • Identify protected fragments by mass spectrometry

  • Cryo-electron microscopy:

    • Purify SecG alone or in complex with SecYE

    • Perform single-particle cryo-EM analysis

    • Determine high-resolution structure in a lipid environment

  • Molecular dynamics simulations:

    • Build computational models of SecG in lipid bilayers

    • Simulate insertion and conformational dynamics

    • Validate predictions with experimental approaches

These methodologies require careful optimization but can provide detailed insights into how SecG functions within the bacterial membrane.

How can recombinant H. pylori SecG contribute to understanding H. pylori adaptation and antibiotic resistance mechanisms?

Recombinant SecG can advance our understanding of H. pylori adaptation through:

  • Comparative studies of clinical isolates:

    • Express and characterize SecG from antibiotic-resistant vs. sensitive strains

    • Identify sequence variations and functional differences

    • Correlate with clinical outcomes and treatment responses

  • Stress response analysis:

    • Investigate how environmental stressors affect SecG expression and function

    • Test acidic conditions mimicking the gastric environment

    • Examine effects of sublethal antibiotic concentrations

  • Role in biofilm formation:

    • Assess SecG's contribution to secretion of biofilm matrix components

    • Test if SecG inhibition reduces biofilm formation

    • Examine SecG expression in planktonic vs. biofilm states

  • Genetic manipulation studies:

    • Create H. pylori strains with modified secG genes

    • Assess impacts on protein secretion, growth, and virulence

    • Test antibiotic susceptibility profiles

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.