Recombinant Helicobacter pylori Protein translocase subunit SecD (secD)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, should you have a specific format preference, kindly indicate it in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributor for precise delivery time.
Note: All protein shipments default to blue ice packs. If dry ice shipping is preferred, please communicate this in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage state, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you require a specific tag type, please inform us and we will prioritize its development.
Synonyms
secD; HP_1550; Protein translocase subunit SecD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-525
Protein Length
full length protein
Species
Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)
Target Names
secD
Target Protein Sequence
MKLFNARLIVFIGALLLGVGFSVPSLLETKGPKITLGLDLRGGLNMLLGVQTDEALKNKY LSLASALEYNAKKQNILLKDIKSNLEGISFELLDEDEAKKLDALLLELQGHSQFEIKKEA GFYSVNLTPLEQEELRKNTILQVIGIIRNRLDQFGLAEPVVIQQGKEEISVQLPGIKTLE EERRAKDLISRSAHLQMMAVDEEHNKDAMKMTDLEAQKLGSVLLSDVEMGGKILLKAIPI LDGEMLTDAKVVYDQNNQPVVSFTLDAQGAKIFGDFSGANVGKRMAIVLDNKVYSAPVIR ERIGGGSGQISGNFSVAQASDLAIALRSGAMSAPIQVLEKRIIGPSLGKDSVKTSIIALV GGFILVMGFMVLYYSMAGVIACLALVVNLFLIVAVMAIFGATLTLPGMAGIVLTVGIAVD ANIIINERIREVLRENEGIAKAIHLGYINASRAIFDSNITSLIASVLLYAYGTGAIKGFA LTTGIGILASIITAIVGTQGIYQALLPKLTQTKSLYFWFGVNKRA
Uniprot No.

Target Background

Function
SecD is a component of the Sec protein translocase complex. It interacts with the SecYEG preprotein conducting channel. SecDF utilizes the proton motive force (PMF) to complete protein translocation after the ATP-dependent function of SecA.
Database Links
Protein Families
SecD/SecF family, SecD subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What methods are most reliable for isolating Helicobacter pylori for SecD protein studies?

Reliable isolation of H. pylori for protein studies requires both invasive and non-invasive techniques depending on research objectives. Biopsy-based methods include histological evaluation, culture, and rapid urease testing, all of which can provide viable bacterial samples for protein extraction . For molecular studies of SecD and other proteins, PCR-based approaches offer high sensitivity for detecting H. pylori DNA in small samples with few bacteria present . When planning isolation protocols, consider that H. pylori shows remarkable genetic diversity, which can affect protein expression patterns across different strains . For optimal results, combine cultivation techniques with molecular verification using PCR targeting conserved genes to confirm successful isolation before proceeding with SecD protein studies.

How does genetic diversity in H. pylori populations affect SecD protein research?

H. pylori is characterized by an unusually high degree of genetic variability compared to other bacterial species, with extensive intraspecific recombination occurring at frequencies much higher than observed in other organisms . This genetic diversity directly impacts protein research, as SecD protein sequences may vary significantly between clinical isolates. DNA sequence analyses have confirmed that H. pylori undergoes frequent horizontal genetic exchange, resulting in linkage equilibrium where different loci and polymorphisms within each locus recombine freely . When conducting SecD research, investigators must account for this genetic plasticity by sequencing the secD gene from multiple isolates and establishing phylogenetic relationships. Research designs should incorporate multiple strain comparisons to determine whether observed protein characteristics represent strain-specific adaptations or conserved functions across the species.

What experimental controls are essential when working with recombinant H. pylori proteins?

Effective experimental design for recombinant H. pylori protein studies requires rigorous controls to ensure validity and reliability . When expressing SecD protein, include both positive controls (known successful expression of similar membrane proteins) and negative controls (expression systems without the secD gene insert). Experimental design should carefully select independent variables (expression conditions, host systems, purification methods) while monitoring dependent variables (protein yield, activity, structure) . Control variables must be held constant to prevent external factors from affecting results—these typically include temperature, pH, and buffer compositions during protein isolation. For SecD functional studies, include controls for membrane fraction purity and protein orientation. Document all experimental conditions in detail to ensure replicability, as recombinant membrane proteins often require highly optimized expression protocols for successful production.

What PCR-based approaches can detect and characterize the secD gene in H. pylori isolates?

PCR offers significant advantages for detecting and characterizing the secD gene in H. pylori, particularly when working with limited sample material. Design primers targeting conserved regions flanking the secD gene, with consideration for the high genetic variability exhibited by H. pylori . For detection in clinical samples, PCR can be performed on materials obtained through both invasive (biopsy) and non-invasive procedures (gastric juice, saliva, stool) . A key advantage of PCR-based characterization is its ability to identify diverse bacterial genotypes, making it valuable for epidemiological studies of SecD variation across populations . When designing primers, consider that H. pylori's high recombination rate may result in sequence variations; degenerate primers or multiple primer sets may be necessary to capture all variants. Following amplification, sequence analysis of PCR products allows precise characterization of secD gene polymorphisms and comparison with reference strains.

How can researchers differentiate between live and non-viable H. pylori when studying protein expression?

Differentiating between live and non-viable H. pylori is crucial when studying protein expression, particularly for accurate interpretation of results. While PCR can detect H. pylori DNA, it presents limitations as it can identify DNA fragments from dead bacteria, potentially leading to false-positive results, especially in post-treatment evaluations . For SecD protein studies, implement RNA-based approaches such as reverse transcription PCR targeting secD mRNA, which indicates active transcription in viable cells. Cultivation methods combined with viability stains can physically separate living bacteria for protein extraction. For functional studies of SecD, use activity-based approaches that measure protein translocation efficiency, which would only be present in viable bacteria with functional membrane systems. These combined approaches ensure that observed SecD protein characteristics accurately reflect those of living H. pylori rather than remnant proteins or DNA from non-viable cells.

What methodological approaches best address contradictions in H. pylori SecD research literature?

Resolving contradictions in H. pylori SecD research requires systematic evaluation of conflicting findings through multiple methodological approaches. Implement contradiction detection strategies similar to those used in clinical literature analysis, where deep learning models have been successfully trained to identify potentially contradictory statements in medical research . When encountering conflicting results about SecD function or structure, first categorize contradictions as either methodology-based or interpretation-based. For methodology contradictions, reproduce experiments using standardized protocols with careful attention to strain differences, growth conditions, and protein extraction methods. For interpretation contradictions, apply ontology-driven classification systems to determine whether differences represent true biological variation or semantic misalignments . Utilize statistical approaches to evaluate whether contradictory findings reach significance thresholds (t=0.35 has been identified as an effective threshold for contradiction analysis in medical literature) . Finally, design experiments specifically to test competing hypotheses about SecD function using multiple complementary techniques rather than relying on single methodological approaches.

How does the high recombination rate in H. pylori affect experimental design for SecD functional studies?

The exceptional recombination rate in H. pylori—significantly higher than in other bacterial species including E. coli and N. meningitidis—necessitates specialized experimental designs for SecD functional studies . When investigating SecD function, researchers must account for the panmictic nature of H. pylori populations, where horizontal genetic exchange occurs so frequently that different loci exist in linkage equilibrium . This genetic fluidity means that SecD variants may co-occur with diverse genetic backgrounds, potentially affecting functional readouts. Experimental designs should include secD sequence typing of all experimental strains alongside whole-genome sequencing to identify potential genetic interactions. Include multiple reference strains representing different phylogenetic lineages to determine if observed SecD functions are conserved across the species or strain-dependent. For genetic manipulation experiments, verify stability of introduced genetic elements, as the high recombination rate can lead to rapid incorporation or modification of introduced DNA. When possible, study naturally occurring strain variants rather than laboratory-manipulated strains to capture authentic functional diversity.

What are the statistical considerations when interpreting contradictory results in H. pylori protein research?

Statistical analysis of contradictory results in H. pylori protein research demands rigorous methodological approaches tailored to this genetically diverse organism. When analyzing SecD protein data, statistical models must account for the high genetic variability inherent in H. pylori populations . Implement statistical frameworks used in clinical contradiction detection, which have demonstrated success in distinguishing genuine biological contradictions from methodological artifacts . For comparing conflicting results across studies, standardize effect sizes rather than p-values, as the latter are highly sensitive to sample size variations. Statistical validation should utilize external datasets where possible, with threshold values (such as t=0.35) established through validation against independently verified contradictions . When integrating data from multiple studies, apply meta-analytical approaches with random effects models to account for between-study heterogeneity. Statistical power calculations should be performed a priori with consideration for the high variability observed in H. pylori strains, typically requiring larger sample sizes than would be needed for more genetically stable organisms.

How can sequential experimental designs enhance the study of H. pylori SecD protein function?

Sequential experimental designs offer powerful approaches for studying H. pylori SecD protein function by systematically building on initial findings through structured research phases. Unlike traditional single-experiment approaches, sequential methodologies similar to sequential therapy protocols for H. pylori can be adapted to protein research contexts . Begin with high-throughput screening of conditions that affect SecD expression or function, followed by focused validation of promising leads. In the first phase, evaluate SecD under multiple experimental conditions (pH, temperature, ion concentrations) to identify factors affecting protein stability and function. In the second phase, conduct detailed mechanistic studies under optimized conditions identified in phase one. This approach has demonstrated superior outcomes in clinical contexts (78% success rate for sequential approaches versus 71% for standard approaches) and can be similarly effective in research settings. Sequential designs are particularly valuable for SecD as a membrane protein translocase, where initial screens can identify potential translocation substrates, followed by detailed kinetic and structural studies of confirmed interactions.

What advanced techniques can differentiate between the roles of SecD and other protein translocase components in H. pylori?

Differentiating the specific contributions of SecD from other protein translocase components requires advanced methodological approaches that isolate individual component functions while maintaining system integrity. Implement conditional expression systems where secD and other translocase genes are placed under inducible promoters, allowing titrated expression of individual components. Combine this with quantitative proteomics to measure how varying SecD levels affect the translocation efficiency of different substrate proteins. Site-directed mutagenesis of conserved SecD domains, informed by comparative sequence analysis across H. pylori strains with different genetic backgrounds , can identify critical functional residues. For in vivo studies, develop fluorescent protein fusions with careful consideration of H. pylori's genetic peculiarities and high recombination rates . Apply super-resolution microscopy techniques to visualize SecD localization and dynamics within the bacterial membrane, especially in relation to other translocase components. Finally, reconstitute purified SecD with other translocase components in artificial membrane systems to measure direct contributions to translocation efficiency through controlled biochemical assays.

What protein purification strategies are most effective for recombinant H. pylori SecD?

Purifying recombinant H. pylori SecD presents significant challenges due to its membrane-embedded nature and requires specialized approaches beyond standard protein purification methods. The optimal strategy begins with selecting an appropriate expression system—typically E. coli strains engineered for membrane protein expression or H. pylori-derived systems for native folding environments. For initial extraction, detergent screening is essential, with mild non-ionic detergents (DDM, LMNG) generally providing better results for maintaining SecD structure than ionic alternatives. Implement a two-step purification protocol beginning with affinity chromatography (typically using His-tagged constructs) followed by size exclusion chromatography to separate SecD from improperly folded aggregates. Throughout purification, maintain conditions that simulate the acidic environment of H. pylori's natural habitat (pH 4.5-6.0) to preserve native conformation. For functional studies, consider reconstituting purified SecD into nanodiscs or liposomes that mimic bacterial membrane composition. Quality control should include both SDS-PAGE analysis and functional assays measuring ATP hydrolysis or substrate protein interaction to verify that purified SecD retains native activity.

How can researchers develop reliable antibodies for H. pylori SecD detection?

Developing reliable antibodies for H. pylori SecD detection requires strategic approaches that account for both protein characteristics and H. pylori's genetic diversity. Begin with comprehensive sequence analysis of SecD across multiple H. pylori strains to identify conserved epitopes that are unique to SecD and accessible in the native protein conformation . For monoclonal antibody development, use recombinant SecD fragments representing extracellular domains rather than transmembrane regions, which are both poorly immunogenic and difficult to maintain in native conformation. When raising polyclonal antibodies, immunize with multiple peptides from different SecD domains to increase detection sensitivity. Validate all antibodies against both recombinant SecD and native protein from multiple H. pylori strains to ensure consistent detection despite strain-to-strain sequence variations . Cross-reactivity testing against related bacterial species is essential to confirm specificity. For research applications requiring quantitative analysis, calibrate antibody detection using purified recombinant SecD standards at known concentrations. When possible, develop antibody pairs recognizing different SecD epitopes to enable sandwich ELISA or other two-site detection methods, which offer superior specificity for complex biological samples.

What experimental designs best evaluate the impact of H. pylori strain variation on SecD function?

Evaluating how H. pylori strain variation affects SecD function requires experimental designs that systematically account for the organism's remarkable genetic diversity and high recombination rate . Implement a multi-strain comparative approach by selecting representative strains from different geographical regions and clinical contexts, as H. pylori shows population stratification despite its high recombination rate . For each strain, sequence the secD gene and surrounding genomic regions to identify variations in both coding sequences and regulatory elements. Design functional assays measuring protein translocation efficiency using standardized substrate proteins expressed in the different H. pylori backgrounds. To distinguish strain-specific effects from experimental variation, employ robust statistical designs with appropriate replication and controls as outlined in experimental design principles . Consider creating chimeric constructs where domains of SecD from different strains are exchanged to pinpoint which sequence variations are functionally significant. For in vivo relevance, correlate SecD sequence variations with phenotypic differences in protein secretion profiles or antibiotic susceptibility patterns across the strain collection.

How can researchers distinguish between contradictory findings in SecD localization studies?

Resolving contradictions in SecD localization studies requires methodological approaches that can distinguish between genuine biological variations and technical artifacts. When confronted with contradictory localization reports, first categorize potential sources of discrepancy using clinical contradiction detection frameworks , focusing on differences in: 1) strains used, 2) growth conditions, 3) detection methods, and 4) analytical techniques. To systematically address contradictions, design validation experiments using multiple complementary techniques—fluorescent protein fusions, immunogold electron microscopy, and subcellular fractionation—on identical bacterial samples. When using fluorescent tags, position them at both N- and C-termini to control for potential interference with localization signals. For immunolocalization, employ multiple antibodies targeting different SecD epitopes to ensure consistent detection patterns. Quantitative image analysis should be applied to objectively measure localization patterns across large numbers of cells, with statistical thresholds (similar to the t=0.35 value used in contradiction analysis ) to determine significant differences. Finally, correlate observed localization patterns with functional assays to determine which localization findings best explain SecD's role in protein translocation.

What computational tools can predict structural features of H. pylori SecD considering strain variation?

Computational prediction of H. pylori SecD structural features must address the challenges posed by high genetic diversity while leveraging available structural data on homologous proteins. Begin with comprehensive sequence alignment of SecD proteins from diverse H. pylori strains to identify conserved regions likely critical for function versus variable regions that may represent strain-specific adaptations . Apply homology modeling using solved structures of bacterial SecD proteins as templates, but implement strain-specific refinement to account for H. pylori's unique sequence characteristics. For transmembrane topology prediction, combine multiple algorithms (TMHMM, MEMSAT, Phobius) and use consensus approaches, as single-algorithm predictions often show discrepancies for complex membrane proteins. Molecular dynamics simulations can evaluate how strain-specific sequence variations might affect protein flexibility and substrate interactions within the bacterial membrane environment. To validate computational predictions, correlate results with experimental data such as limited proteolysis patterns or cysteine accessibility. For functional prediction, implement protein-protein interaction algorithms to identify potential SecD binding partners within the H. pylori secretion machinery, which can then guide targeted experimental validation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.