Recombinant Helicobacter pylori Protein translocase subunit SecF (secF)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant SecF is engineered for high yield and purity, as detailed below:

PropertySpecification
Expression HostE. coli, yeast, baculovirus, or mammalian cells
Purity≥85% (SDS-PAGE)
ApplicationsStructural studies, enzymatic assays, and functional analysis of protein export

Functional Role in H. pylori

The Sec translocase in H. pylori is distinct from the Twin-Arginine Translocation (Tat) system, which uses TatA/B/C for redox enzyme transport . SecF contributes to:

  • Preprotein Translocation: Post-translational export of secretory proteins via the Sec pathway.

  • Membrane Integration: Assists in the insertion of membrane proteins through coordinated action with SecD .

Proteomic Studies

Differential proteomics of H. pylori clinical isolates revealed upregulated TatB (a Tat system component) in ulcer and cancer strains, highlighting the Sec system’s conserved role in basic protein export across pathologies .

Comparative Analysis with Tat System

While the Tat system exports folded proteins (e.g., catalase-associated KapA), SecF-mediated translocation is essential for unfolded preproteins. The Tat system’s substrate specificity contrasts sharply with the Sec pathway’s broader role .

Applications in Biomedical Research

  • Antibiotic Target Exploration: SecF’s role in viability makes it a candidate for anti-H. pylori drug development.

  • Mechanistic Studies: Recombinant SecF enables in vitro reconstitution of translocation machinery to study bacterial secretion .

Future Directions

Current gaps include structural resolution of the H. pylori SecYEGDF complex and in vivo functional validation. Further studies could explore SecF’s interaction with virulence factors like CagA, a T4SS effector linked to gastric pathogenesis .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will fulfill your request if possible.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are collected at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life is influenced by factors such as storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us and we will prioritize its development.
Synonyms
secF; HP_1549; Protein translocase subunit SecF
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-323
Protein Length
full length protein
Species
Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)
Target Names
secF
Target Protein Sequence
MELFKRTRILSFMRYSNYGVIVSAILALLALGLLFFKGFSLGIDFAGGSLVQVRYTQNAP IKEVRDLFEKEARFKGVQVSEFGSKEEILIKFPFVETAENEDLNAIVANILKPSGDFEIR KFDTVGPRVGSELKEKGILSLILALIAIMVYVSFRYEWRFALASVIALVHDVILVASSVI VFKIDMNLEVIAALLTLIGYSINDTIIIFDRIREEMLSQKTKNATQAIDEAISSTLTRTL LTSLTVFFVVLILCVFGSKIIIGFSLPMLIGTIVGTYSSIFIAPKVALLLGFDMDKYYEN ETRKIKKAQEKEKMRRLYESGQV
Uniprot No.

Target Background

Function
This protein is a component of the Sec protein translocase complex. It interacts with the SecYEG preprotein conducting channel. SecDF utilizes the proton motive force (PMF) to complete protein translocation after the ATP-dependent function of SecA.
Database Links
Protein Families
SecD/SecF family, SecF subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of Protein translocase subunit SecF in Helicobacter pylori?

Protein translocase subunit SecF is a component of the bacterial Sec protein translocation pathway, which is essential for protein secretion across the cytoplasmic membrane in H. pylori. SecF works in conjunction with SecD and SecY to form a membrane-integrated complex that facilitates the translocation of proteins across the membrane by providing the driving force through proton motive force utilization. In H. pylori, this system is crucial for the secretion of various virulence factors that contribute to pathogenicity and colonization of the gastric mucosa . The SecYEG-SecDF complex represents one of several secretion pathways that H. pylori employs to export proteins to the extracellular environment, distinguishing it from the Type IV Secretion Systems that are also present in this pathogen .

How is recombinant H. pylori SecF typically expressed and purified?

Recombinant H. pylori SecF is typically expressed in Escherichia coli expression systems, which provide a convenient platform for producing bacterial membrane proteins . The expression generally involves:

  • Cloning the secF gene into an appropriate expression vector

  • Transformation into a suitable E. coli strain (typically BL21(DE3) or derivatives)

  • Induction of protein expression using IPTG or auto-induction systems

  • Cell lysis and membrane fraction isolation

  • Detergent solubilization of the membrane protein

  • Purification using affinity chromatography (His-tag is commonly used)

  • Additional purification steps such as ion exchange or size exclusion chromatography

The resulting purified protein typically achieves >85% purity as determined by SDS-PAGE . For optimal stability, the protein should be stored at -20°C/-80°C, with glycerol added to a final concentration of approximately 50% to prevent freeze-thaw damage .

What are the recommended storage conditions for recombinant H. pylori SecF?

The stability and shelf life of recombinant H. pylori SecF depend on several factors including storage temperature, buffer composition, and protein formulation. Optimal storage conditions include:

  • For liquid formulations: Store at -20°C to -80°C with a typical shelf life of 6 months

  • For lyophilized preparations: Store at -20°C to -80°C with an extended shelf life of up to 12 months

  • Addition of 5-50% glycerol (typically 50%) as a cryoprotectant is recommended for liquid formulations

  • Aliquoting the protein to avoid repeated freeze-thaw cycles

  • Reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL when using lyophilized protein

  • For short-term use, working aliquots can be stored at 4°C for up to one week

What expression systems are most effective for producing functional H. pylori SecF?

While E. coli is the most commonly used expression system for recombinant H. pylori proteins including SecF, several considerations should be addressed when selecting an optimal expression system:

Based on the optimization approaches used for other H. pylori recombinant proteins like HpaA, the culture conditions for E. coli expressing SecF can be systematically optimized using methodologies such as response surface methodology (RSM) and artificial neural network (ANN) to significantly improve yield . Key parameters to optimize include media composition (particularly glucose, yeast extract, and NH₄Cl concentrations), induction timing, and temperature post-induction.

How can I assess the functional activity of purified recombinant SecF?

Evaluating the functional activity of recombinant SecF requires methods that assess its native membrane-associated functions:

  • ATPase Activity Assay: Although SecF itself is not an ATPase, it works in conjunction with the SecA ATPase. Reconstituting the Sec system components can allow measurement of ATP hydrolysis rates.

  • Protein Translocation Assays: In vitro reconstitution of protein translocation using purified components and model substrates. This can be assessed by:

    • Protease protection assays measuring the translocation of radioactively labeled substrates

    • Fluorescence-based assays using labeled protein substrates

  • Interaction Studies:

    • Pull-down assays to verify interactions with other Sec pathway components

    • Surface plasmon resonance (SPR) to measure binding kinetics with SecD, SecY, or substrate proteins

  • Reconstitution in Proteoliposomes:

    • Incorporation of purified SecF into artificial liposomes

    • Assessment of proton gradient coupling and protein translocation

The functional activity assessment should account for SecF's role in the larger Sec machinery context rather than as an isolated protein, as its function is dependent on proper complex formation with other components of the translocase system.

What are the critical factors for optimizing recombinant SecF yield in E. coli?

Optimizing the yield of recombinant H. pylori SecF in E. coli requires careful consideration of several factors:

  • Culture Media Composition:

    • Carbon source: Glucose concentration significantly impacts yield

    • Nitrogen sources: Yeast extract, peptone, and NH₄Cl are critical components

    • Trace elements: CaCl₂ and other divalent cations can influence protein expression

  • Induction Parameters:

    • Inducer concentration (IPTG typically between 0.1-1.0 mM)

    • Cell density at induction (optimal OD₆₀₀ typically between 0.6-0.8)

    • Post-induction temperature (lower temperatures like 16-25°C often favor proper folding)

    • Duration of induction (4-24 hours depending on temperature)

  • Strain Selection:

    • Strains with reduced proteolytic activity

    • Strains optimized for membrane protein expression (C41/C43)

    • Strains with rare codon supplementation

  • Optimizing Solubilization and Purification:

    • Selection of appropriate detergents (DDM, LDAO, or C₁₂E₈)

    • Buffer composition and pH optimization

    • Presence of stabilizing agents during purification

Statistical optimization approaches using response surface methodology (RSM) and artificial neural network linked genetic algorithm (ANN-GA) models have shown superior results for other H. pylori recombinant proteins, with ANN-GA often providing more accurate predictions for complex biological systems .

How does SecF contribute to H. pylori virulence and pathogenesis?

The SecF protein, as part of the Sec translocation machinery, plays an indirect but crucial role in H. pylori pathogenesis by facilitating the translocation of numerous virulence factors across the cytoplasmic membrane. While not a virulence factor itself, SecF affects pathogenesis through:

  • Virulence Factor Secretion: The Sec pathway is essential for the secretion of multiple H. pylori virulence factors that are subsequently released to the extracellular environment or remain associated with the cell wall. These include urease, adhesins, and various enzymes that contribute to colonization and inflammation .

  • Growth Phase-Dependent Secretion: H. pylori exhibits growth phase-dependent secretion of proteins, with different virulence factors predominating during different growth phases. The SecF-containing translocation machinery must adapt to these changing requirements. For example, VacA toxin shows higher proportional abundance in culture supernatant during late growth phases compared to early growth phases .

  • Membrane Protein Integration: Beyond secretion, the Sec pathway also facilitates the integration of membrane proteins, including those involved in adhesion to host cells and nutrient acquisition.

  • Stress Response: SecF contributes to stress adaptation by facilitating the secretion of proteins involved in stress responses, which is critical for H. pylori persistence in the hostile gastric environment.

Understanding the role of SecF in these processes could potentially provide insights into new therapeutic approaches targeting protein secretion rather than conventional antibiotic strategies.

How can recombinant SecF be utilized in developing diagnostic tests for H. pylori infection?

Recombinant H. pylori SecF has potential applications in developing improved serological diagnostic tests for H. pylori infection, particularly as part of a multi-antigen approach:

  • Serological Assay Development:

    • Incorporation into line immunoassay systems similar to the recomLine assay described for other H. pylori antigens

    • Potential combination with established immunogenic proteins like CagA, VacA, GroEL, gGT, HcpC, and UreA to enhance sensitivity and specificity

  • Advantages as a Diagnostic Target:

    • As an essential component of the Sec machinery, SecF is likely to be conserved across H. pylori strains

    • Being less exposed to selective immune pressure than major virulence factors, SecF might show less antigenic variation

    • May provide complementary information to existing virulence factor-based diagnostics

  • Validation Requirements:

    • Assessment of immunoreactivity in patient sera

    • Determination of sensitivity and specificity compared to histological confirmation

    • Evaluation of cross-reactivity with other bacterial species

  • Clinical Application Considerations:

    • Potential for discriminating between type I and type II strains if differential expression is confirmed

    • Utility in population-based screening programs in high gastric cancer risk areas

Current serological tests for H. pylori infection face challenges in sensitivity and specificity (97.6% and 96.2% respectively for advanced line immunoassays) , suggesting room for improvement through the inclusion of additional antigens like SecF.

What structural and functional insights have been gained from studies of the SecDF complex in H. pylori compared to other bacterial species?

The SecDF complex in H. pylori shares fundamental structural features with homologs in other bacterial species but also exhibits unique characteristics:

More detailed structural studies, potentially using cryo-electron microscopy, could provide valuable insights into the species-specific adaptations of the H. pylori SecDF complex.

What are common technical challenges in working with recombinant H. pylori SecF and how can they be overcome?

Researchers working with recombinant H. pylori SecF frequently encounter several technical challenges:

  • Low Expression Yields:

    • Problem: Membrane proteins often express poorly in heterologous systems.

    • Solution: Optimize expression conditions using statistical methods like RSM and ANN-GA models . Consider using specialized strains like C41/C43, lower induction temperatures (16-20°C), and extended induction times (16-24 hours).

  • Protein Aggregation and Inclusion Body Formation:

    • Problem: Improper folding leading to aggregation.

    • Solution: Co-express with molecular chaperones, use fusion tags that enhance solubility, and optimize buffer conditions during expression and purification.

  • Detergent Selection for Solubilization:

    • Problem: Different detergents can dramatically affect protein stability and activity.

    • Solution: Screen multiple detergents (DDM, LDAO, OG, C₁₂E₈) in small-scale experiments before large-scale purification. Consider detergent mixtures or amphipols for long-term stability.

  • Maintaining Functional Activity:

    • Problem: Loss of activity during purification and storage.

    • Solution: Include lipids during purification, use glycerol (5-50%) as a stabilizer , and store in smaller aliquots to minimize freeze-thaw cycles.

  • Protein Heterogeneity:

    • Problem: Multiple conformational states or degradation products.

    • Solution: Optimize purification protocols to include multiple chromatography steps, consider adding protease inhibitors, and perform quality control using SEC-HPLC to ensure homogeneity.

  • Reconstitution Challenges:

    • Problem: Difficulties in reconstituting purified SecF into functional membrane environments.

    • Solution: Carefully control protein-to-lipid ratios, optimize reconstitution conditions including detergent removal rates, and consider nanodisc technology for stabilization.

How can researchers address experimental variability in SecF function and structure studies?

Addressing experimental variability in SecF studies requires systematic approaches:

  • Standardization of Expression and Purification:

    • Establish detailed SOPs for all procedures

    • Use the same E. coli strain, vector, and expression conditions across experiments

    • Implement quality control checkpoints throughout the purification process

  • Protein Quality Assessment:

    • Consistently verify protein integrity using multiple methods:

      • SEC-HPLC for homogeneity assessment

      • Circular dichroism (CD) spectroscopy for secondary structure verification

      • Thermal shift assays for stability monitoring

      • Mass spectrometry to confirm protein identity and purity

  • Functional Assay Standardization:

    • Develop robust functional assays with appropriate controls

    • Use internal standards to normalize between experimental batches

    • Establish clear acceptance criteria for protein functionality

  • Environmental Condition Control:

    • Maintain strict temperature control during experiments

    • Use consistent buffer compositions with precise pH monitoring

    • Control oxygen exposure for sensitive proteins

  • Statistical Approaches:

    • Employ statistical design of experiments (DoE) to systematically assess factor effects

    • Use ANN models which have shown superior predictive accuracy compared to RSM for complex biological systems

    • Perform sufficient technical and biological replicates to establish significance

  • Documentation and Reporting:

    • Maintain detailed records of all experimental conditions

    • Report all relevant parameters in publications to enable reproduction

    • Consider depositing standardized protocols in repositories like Protocols.io

What are the critical considerations when designing experiments to study SecF interactions with other Sec pathway components?

Studying SecF interactions with other Sec pathway components requires careful experimental design:

  • Reconstitution of Multiprotein Complexes:

    • Challenge: The Sec system functions as a multiprotein complex.

    • Approach: Develop co-expression systems for multiple components or sequential reconstitution methods. Consider using multicistronic vectors or dual-plasmid systems.

  • Detection Methods for Protein-Protein Interactions:

    • In vitro methods:

      • Surface plasmon resonance (SPR) for real-time binding kinetics

      • Isothermal titration calorimetry (ITC) for thermodynamic parameters

      • Crosslinking coupled with mass spectrometry for interaction interfaces

    • In vivo methods:

      • Bacterial two-hybrid systems adapted for membrane proteins

      • FRET-based assays using fluorescently tagged proteins

      • Co-immunoprecipitation with antibodies specific for SecF or partner proteins

  • Functional Validation of Interactions:

    • Assess the impact of mutations at putative interaction sites

    • Correlate binding data with functional translocation assays

    • Use complementation studies in SecF-depleted strains

  • Consideration of Native Membrane Environment:

    • Use nanodiscs or proteoliposomes to provide a native-like membrane environment

    • Consider the lipid composition's impact on protein interactions

    • Evaluate the role of proton motive force in complex formation and function

  • Dynamic Nature of Interactions:

    • Design experiments to capture transient interactions

    • Consider time-resolved approaches to study the dynamics of complex formation

    • Investigate how substrate binding affects interactions between Sec components

  • Controls and Validation:

    • Include well-characterized interaction pairs as positive controls

    • Use non-interacting proteins as negative controls

    • Validate key findings using multiple, complementary techniques

What are promising avenues for developing SecF-targeted anti-H. pylori therapeutics?

The essential role of SecF in protein translocation presents several potential therapeutic approaches:

  • Small Molecule Inhibitors:

    • Develop compounds that bind specifically to H. pylori SecF, disrupting its function

    • Target the interface between SecF and other Sec components to prevent complex formation

    • Design molecules that lock SecF in a non-functional conformation

  • Peptide-Based Inhibitors:

    • Design peptides that mimic natural substrates but block the translocation channel

    • Develop peptides targeting species-specific regions of SecF

    • Use phage display or rational design approaches to identify high-affinity peptides

  • Combination Therapies:

    • Pair SecF inhibitors with conventional antibiotics to reduce emergence of resistance

    • Target multiple secretion pathways simultaneously (Sec system plus Type IV secretion systems)

    • Combine with urease inhibitors to create synergistic effects

  • Delivery Strategies:

    • Develop acid-resistant formulations for gastric delivery

    • Explore nanoparticle-based delivery systems for targeted release

    • Consider probiotic-based delivery systems that can coexist with H. pylori

  • Advantages Over Current Approaches:

    • Potential to overcome antibiotic resistance issues

    • Targeting an essential bacterial process not present in human cells

    • Possibility for reduced impact on normal microbiota compared to broad-spectrum antibiotics

These approaches would require extensive validation, including demonstration that inhibition of SecF leads to reduced virulence factor secretion and diminished H. pylori pathogenicity in relevant models.

How might integrating SecF into multi-antigen vaccines enhance protection against H. pylori?

Incorporating SecF into multi-antigen vaccine approaches could offer several advantages:

  • Comprehensive Immune Response Targeting:

    • Including SecF alongside established immunogenic proteins like HpaA could provide broader epitope coverage

    • The combination of conserved (SecF) and variable (virulence factors) antigens may offer more robust protection

    • Multi-antigen formulations have shown enhanced immune responses in previous H. pylori vaccine studies

  • Potential Adjuvant Selection and Delivery Formats:

    • Mucosal adjuvants (cholera toxin B subunit, heat-labile enterotoxin)

    • TLR agonists (CpG, flagellin)

    • Nanoparticle-based delivery systems

    • Live attenuated vector vaccines expressing multiple antigens

  • Immune Response Considerations:

    • Balance between Th1 and Th17 responses for optimal protection

    • Induction of secretory IgA at the gastric mucosa

    • Cell-mediated responses against multiple bacterial targets

  • Protection Assessment Metrics:

    • Bacterial load reduction in animal models

    • Histopathological improvements

    • Longevity of protective immune responses

    • Cross-protection against diverse H. pylori strains

Similar to the recombinant HpaA production optimization described in search result , large-scale production of SecF would require systematic optimization of culture conditions. The successful approaches used for rHpaA, which achieved a 93.2% increase in yield through statistical optimization of medium components, could serve as a model for enhancing SecF production for vaccine applications .

What comparative genomic and proteomic approaches could reveal SecF evolutionary adaptations in H. pylori?

Understanding the evolutionary adaptations of SecF in H. pylori requires sophisticated comparative approaches:

  • Comparative Genomic Analysis:

    • Sequence comparison of secF genes across multiple H. pylori strains from different geographical regions

    • Analysis of selection pressure on different domains of the protein

    • Identification of strain-specific polymorphisms and their correlation with clinical outcomes

    • Examination of the genomic context of secF and associated genes across bacterial species

  • Structural Bioinformatics:

    • Homology modeling of H. pylori SecF based on available crystal structures from other bacteria

    • Molecular dynamics simulations to assess structural stability in acidic environments

    • Prediction of conformational changes during the translocation cycle

    • Identification of potential species-specific interaction interfaces

  • Comprehensive Proteomic Approaches:

    • Comparative proteomic analysis of H. pylori secretomes across growth phases

    • Quantitative assessment of SecF expression levels in different strains

    • Identification of post-translational modifications specific to H. pylori SecF

    • Analysis of the SecF interactome using proximity labeling methods

  • Functional Genomics:

    • CRISPR-based genome editing to introduce targeted mutations

    • Complementation studies using secF genes from different bacterial species

    • Transcriptional analysis to identify regulatory networks controlling secF expression

    • Evaluation of fitness effects of secF variations in different environmental conditions

These approaches could reveal how H. pylori SecF has evolved specific adaptations for functioning in the unique gastric environment and for translocating specialized virulence factors that contribute to the bacterium's remarkable persistence in the human stomach.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.