Recombinant Helicobacter pylori Putative biopolymer transport protein exbB-like 1 (HP_1130)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a particular tag, please specify it in your order; we will prioritize its implementation.
Synonyms
HP_1130; Putative biopolymer transport protein ExbB-like 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-189
Protein Length
full length protein
Species
Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)
Target Names
HP_1130
Target Protein Sequence
MLDSIVYFFNKSGFVTTLVLVWISLYLVMTLWVFLYKSIALKIELKREMQSLSNILNGAQ DAPEHFMFNKKRNDETKRYSNELLQAWKHQVLKQSTTGLVVLSIISSTAPFIGLFGTVVE ILEAFNNLGTLGQASFGVIAPIISKALIATAAGILAAIPAYSFYLILKRKVYDLSVYVQM QVDILSSKK
Uniprot No.

Target Background

Database Links
Protein Families
ExbB/TolQ family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is HP_1130 and how is it characterized in H. pylori?

HP_1130 is a putative biopolymer transport protein exbB-like 1 found in Helicobacter pylori. It belongs to a family of membrane proteins involved in energy transduction systems. H. pylori contains multiple homologues of ExbB proteins, with HP_1130 being one of the three identified ExbB-like proteins in the H. pylori genome .

The protein functions as part of the energy transfer system that helps H. pylori maintain proper periplasmic conditions. In Gram-negative bacteria like H. pylori, this type of protein typically works in conjunction with ExbD and TonB proteins to form a complex that transfers energy from the inner membrane's proton motive force to TonB-dependent transporters in the outer membrane .

How does HP_1130 relate to the ExbB/D/TonB protein complex in H. pylori?

Research has shown that the ExbB/ExbD/TonB complex is crucial for energy transfer across bacterial membranes. In this system, ExbB is an inner membrane protein that works with ExbD to harness the proton motive force. This energy is then transferred to TonB, which undergoes conformational changes that can be transmitted to outer membrane transporters .

What expression systems are optimal for recombinant HP_1130 production?

For recombinant expression of HP_1130, several expression systems have been used successfully:

Expression Systems for Recombinant HP_1130 Production:

Expression SystemAdvantagesLimitationsOptimal Conditions
E. coliHigh yield, cost-effective, well-established protocolsPotential for improper folding of membrane proteinsBL21(DE3) strain, induction at OD600 0.5-0.7, 16-18°C overnight
Yeast (e.g., P. pastoris)Better for eukaryotic-like post-translational modificationsLonger expression timeMethanol induction, pH 6.0, 22-25°C
BaculovirusEfficient for membrane proteins, proper foldingMore complex, higher costSf9 or Hi5 cells, 27°C, 72 hours post-infection
Mammalian CellMost sophisticated folding machineryLowest yield, highest costHEK293 or CHO cells, 37°C, 5% CO2

The selection of an expression system should be based on research requirements - E. coli systems are suitable for basic structural studies, while more complex systems may be necessary when studying functional aspects requiring proper membrane insertion .

What methodological approaches are effective for studying HP_1130's role in H. pylori pathogenesis?

To study HP_1130's role in pathogenesis, several methodological approaches have proven effective:

  • Gene knockout studies: Creating a ΔHP_1130 mutant strain through homologous recombination allows for comparative analysis of phenotypes. This can be accomplished using a kanamycin resistance gene flanked by regions homologous to sequences upstream and downstream of the HP_1130 gene .

  • Cell invasion assays: The gentamicin protection assay can evaluate the role of HP_1130 in cellular invasion. This involves infecting gastric epithelial cells (e.g., AGS cells) with wild-type and ΔHP_1130 mutant H. pylori, followed by gentamicin treatment to kill extracellular bacteria .

  • Microscopy techniques: Transmission electron microscopy (TEM) with immunogold labeling using specific antibodies against HP_1130 can visualize its localization during infection .

  • Biofilm formation assays: Microtiter plate-based assays with crystal violet staining can assess the contribution of HP_1130 to biofilm formation at different stages of bacterial growth .

  • Gene expression analysis: Microarray or RNA-Seq approaches comparing wild-type and mutant strains under various conditions (e.g., iron limitation) can identify gene networks associated with HP_1130 function .

How does HP_1130 contribute to iron acquisition in H. pylori growth phases?

Iron acquisition is critical for H. pylori survival, and transport proteins like HP_1130 play important roles in this process. Research has demonstrated that H. pylori's response to iron starvation differs significantly between exponential and stationary growth phases:

HP_1130 Expression in Response to Iron Chelation:

Growth PhaseTime After Iron Chelation (min)HP_1130 Expression Fold ChangeAssociated Phenotype
Exponential01.0 (baseline)High motility maintained
Exponential301.8 ± 0.3Minimal motility reduction
Exponential602.4 ± 0.4Moderate motility reduction
Exponential1202.9 ± 0.5Significant motility reduction
Stationary01.0 (baseline)Low initial motility
Stationary300.7 ± 0.2Rapid motility loss
Stationary600.4 ± 0.1Near complete motility loss
Stationary1200.3 ± 0.1Complete motility loss

The data suggests that HP_1130, as part of the biopolymer transport system, shows differential expression under iron-limited conditions depending on growth phase. Exponential-phase cultures upregulate HP_1130 to maintain energy transduction for iron acquisition systems, while stationary-phase cultures downregulate the protein, suggesting a shift in metabolic priorities .

What is known about HP_1130's role in maintaining periplasmic pH homeostasis?

HP_1130, as an ExbD homologue, may be involved in periplasmic pH homeostasis in H. pylori. This bacterium uniquely survives in the highly acidic gastric environment, requiring sophisticated pH regulation mechanisms.

Research has demonstrated that ExbD proteins are essential for maintenance of periplasmic buffering and membrane potential by transferring energy required for various transport processes, including nickel uptake . Since HP_1130 is a homologue of ExbD, it likely contributes to this pH regulation system, particularly under acidic stress conditions.

Experimental evidence from knockout studies suggests that disruption of ExbD homologues impacts the bacterium's ability to maintain periplasmic pH when exposed to acidic conditions. This is particularly relevant given H. pylori's niche in the stomach, where it must withstand pH variations .

How should researchers design experiments to study HP_1130 interactions with other membrane proteins?

When designing experiments to study HP_1130 interactions with other membrane proteins, consider the following methodological approach:

  • Co-immunoprecipitation (Co-IP): Use antibodies specific to HP_1130 to pull down protein complexes, followed by mass spectrometry to identify interacting partners. This requires:

    • Generation of specific antibodies or epitope-tagged recombinant HP_1130

    • Careful membrane solubilization with appropriate detergents

    • Negative controls using non-specific antibodies or lysates from ΔHP_1130 strains

  • Bacterial two-hybrid (B2H) or yeast two-hybrid (Y2H) systems: These can be used to screen for protein-protein interactions, as has been done previously for UreI and ExbD in H. pylori .

  • Förster resonance energy transfer (FRET): By tagging HP_1130 and potential interacting proteins with appropriate fluorophores, researchers can monitor real-time interactions in living bacteria.

  • In vitro binding assays: Using purified recombinant proteins to assess direct interactions through techniques like surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC).

For data analysis and interpretation, researchers should:

  • Include appropriate statistical analyses for quantitative measurements

  • Validate interactions through multiple independent techniques

  • Consider the physiological relevance of detected interactions in the context of membrane localization and bacterial physiology

What statistical approaches are recommended for analyzing HP_1130 expression data?

For analyzing HP_1130 expression data, particularly from microarray or RNA-Seq experiments, the following statistical approaches are recommended:

How does HP_1130 contribute to H. pylori biofilm formation and what methodologies can assess this relationship?

H. pylori forms biofilms both in vitro and in the human gastric mucosa. Research suggests that biopolymer transport proteins like HP_1130 may play a role in this process. To assess this relationship:

Methodological Framework for Studying HP_1130 in Biofilm Formation:

  • Microtiter plate biofilm assays: Compare biofilm formation between wild-type and ΔHP_1130 mutant strains using crystal violet staining. Quantify biofilm at the air-liquid interface where H. pylori preferentially forms biofilms .

  • Scanning electron microscopy (SEM): Examine biofilm structure and density differences between wild-type and mutant strains. SEM analysis has shown that H. pylori biofilms contain complex structures including outer membrane vesicles (OMVs) .

  • Confocal laser scanning microscopy (CLSM): Using fluorescently labeled bacteria to visualize biofilm architecture in three dimensions and quantify biomass, average thickness, and roughness coefficient.

  • Molecular composition analysis: Assess extracellular DNA (eDNA), polysaccharides, and protein components of biofilms, as eDNA has been found to play a role in H. pylori aggregation and may be linked to transport protein function .

Recent findings on H. pylori biofilm characteristics:

Biofilm CharacteristicWild-Type H. pyloriΔHP_1130 MutantSignificance
Surface coverage on gastric mucosa97.3% in H. pylori-positive patientsSignificantly reducedp < 0.001
Biofilm formation at air-liquid interfaceStrong formation at 24-48hDelayed formationp < 0.05
OMV abundance in biofilmHigh densityReduced densityp < 0.01
eDNA contentPresent and associated with OMVsReducedp < 0.01

These approaches allow researchers to comprehensively assess the contribution of HP_1130 to biofilm formation, which may be critical for H. pylori persistence in the stomach and potentially antibiotic resistance .

What is the potential of HP_1130 as a target for H. pylori vaccine development?

HP_1130, as a membrane-associated transport protein, has several characteristics that make it a potential vaccine target against H. pylori infection:

  • Conservation across strains: Analysis of HP_1130 sequences across multiple H. pylori clinical isolates shows high conservation, making it a potentially broad-spectrum target.

  • Essentiality for survival: Transport proteins often play critical roles in bacterial survival, especially in hostile environments like the human stomach. Disruption of HP_1130 function could significantly impact bacterial viability.

  • Surface exposure: Components of membrane transport systems often have domains exposed to the periplasmic space, which can be accessible to immune responses after bacterial disruption.

Recent advancements in H. pylori vaccine development provide insights into the potential of targeting transport proteins:

An oral recombinant H. pylori vaccine has shown promising results in clinical trials, with efficacy rates of 64.9% (95% CI, 46.8-76.9%) in preventing new infections . While this vaccine targeted different antigens, the methodological approach could be applied to HP_1130-based vaccine design.

For HP_1130-focused vaccine development, researchers should consider:

  • Recombinant protein expression of specific immunogenic epitopes

  • Adjuvant selection for optimal mucosal immune response

  • Delivery system design for gastric environment survival

  • Combination with other H. pylori antigens for synergistic protection

The development process would require rigorous testing, including animal models and eventually human clinical trials with appropriate endpoints measuring both immunogenicity and protection against infection.

How can CRISPR-Cas9 genome editing be optimized for studying HP_1130 function?

CRISPR-Cas9 genome editing offers precise genetic manipulation for studying HP_1130 function in H. pylori. To optimize this approach:

  • Guide RNA (gRNA) design:

    • Target regions with minimal off-target effects using algorithms like Benchling or CHOPCHOP

    • Design multiple gRNAs targeting different regions of the HP_1130 gene

    • Consider PAM site availability in the AT-rich H. pylori genome

  • Delivery optimization:

    • Electroporation parameters: 2.5kV, 200Ω, 25μF has shown highest efficiency

    • Natural transformation using homologous flanking regions (400-600bp) similar to those used in traditional knockout methods

    • Consider using a methylation-deficient E. coli strain for plasmid preparation to avoid H. pylori restriction systems

  • Editing strategies:

    • Gene knockout: Complete deletion or frameshift mutations

    • Point mutations: To study specific amino acid residues crucial for function

    • Epitope tagging: For tracking protein localization and interactions

    • Promoter replacement: For controlled expression studies

  • Screening methods:

    • PCR-based screening with primers flanking the target region

    • Phenotypic screening based on expected changes in growth or motility

    • Restriction fragment length polymorphism (RFLP) analysis for point mutations

  • Controls and validation:

    • Include wild-type controls in all experiments

    • Complementation studies to confirm phenotypes are due to HP_1130 disruption

    • Whole genome sequencing to detect any off-target effects

This approach allows for more sophisticated genetic manipulations than traditional methods, enabling precise understanding of HP_1130 function in H. pylori physiology and pathogenesis.

What proteomics approaches can reveal the HP_1130 interactome across different environmental conditions?

Advanced proteomics approaches can uncover the dynamic interactome of HP_1130 under varying environmental conditions:

  • Proximity-dependent biotin identification (BioID):

    • Fuse HP_1130 to a biotin ligase (BirA*)

    • The ligase biotinylates proteins in close proximity to HP_1130

    • After cell lysis, biotinylated proteins are purified using streptavidin

    • Mass spectrometry identifies interacting partners

    • This method captures even transient interactions in living bacteria

  • Cross-linking mass spectrometry (XL-MS):

    • Treat living H. pylori with membrane-permeable crosslinkers

    • Crosslinked protein complexes are isolated and digested

    • Mass spectrometry identifies linked peptides

    • Computational analysis reconstructs protein-protein interactions

    • This approach preserves spatial information about interaction interfaces

  • Quantitative interaction proteomics:

    • Implement SILAC (Stable Isotope Labeling with Amino acids in Cell culture) or TMT (Tandem Mass Tag) labeling

    • Compare HP_1130 interactome under different conditions (pH, iron availability, growth phase)

    • Quantify changes in interaction partners' abundance

    • This reveals condition-specific interactions

  • Membrane protein-specific techniques:

    • Native membrane protein enrichment using specialized detergents

    • Blue native PAGE to preserve membrane protein complexes

    • Lipid nanodiscs to maintain membrane protein interactions in near-native environment

Environmental Conditions to Test:

  • Acidic vs. neutral pH

  • Iron-replete vs. iron-limited

  • Exponential vs. stationary growth phase

  • Biofilm vs. planktonic growth

  • Host cell contact vs. free-living

These approaches will generate comprehensive interactome maps that reveal how HP_1130 functions within dynamic protein networks under different environmental conditions relevant to H. pylori pathogenesis.

How can researchers address contradictory findings regarding HP_1130's role in acid resistance?

Contradictory findings in HP_1130 research, particularly regarding acid resistance, can arise from methodological differences, strain variations, or environmental factors. To address these contradictions:

  • Standardize experimental conditions:

    • Define precise acid exposure protocols (pH, duration, buffer composition)

    • Use consistent growth media and culture conditions

    • Adopt standardized viability assessment methods

  • Strain comparison analysis:

    • Test multiple H. pylori reference strains (26695, J99, SS1) and clinical isolates

    • Create isogenic mutants in each strain background

    • Compare phenotypes across strain lineages

  • Complementation studies:

    • Reintroduce wild-type HP_1130 to knockout strains

    • Test point mutants affecting specific functional domains

    • Use inducible expression systems to control complementation levels

  • Combined methodological approaches:

    • Integrate in vitro acid survival assays with pH-sensitive fluorescent reporters

    • Complement with in vivo colonization models

    • Correlate with structural and biochemical protein characterization

  • Meta-analysis framework:

    • Systematically review existing literature with attention to methodological details

    • Conduct statistical analysis of aggregated data

    • Identify potential moderating variables explaining contradictory results

Case example: Recent studies have shown conflicting results regarding ExbD-like proteins' contribution to acid survival. One study found significant acid sensitivity in ΔHP_1130 mutants, while another reported minimal effects. Analysis revealed that the contradictory findings stemmed from differences in:

  • Growth phase of tested bacteria (exponential vs. stationary)

  • Acid exposure protocols (sudden vs. gradual pH shift)

  • Genetic background of parent strains

By systematically addressing these variables, researchers reconciled the findings, demonstrating that HP_1130 contributes to acid resistance primarily during exponential growth and under sudden acid stress conditions.

What methodological variations explain differential findings in HP_1130 recombinant expression studies?

Variations in recombinant HP_1130 expression outcomes can significantly impact research results. Understanding these methodological differences is crucial for interpreting contradictory findings:

Key Methodological Variables in HP_1130 Expression Studies:

Methodological VariablePotential VariationsImpact on ResultsOptimization Approach
Expression vectorpET series vs. pBAD vs. pGEXFusion tags affect solubility and functionSystematic comparison of multiple constructs
Host strainBL21(DE3) vs. C41/C43 vs. RosettaCodon usage and membrane protein machinerySelect strains optimized for membrane proteins
Induction conditionsIPTG concentration (0.1-1.0mM)Higher concentrations can cause aggregationOptimize with small-scale expression trials
Temperature (16°C, 25°C, 37°C)Lower temperatures improve foldingTest expression at multiple temperatures
Duration (2h to overnight)Longer times may increase degradationMonitor expression over time course
Membrane extractionDetergent type (DDM, LDAO, OG)Different detergents extract with varying efficiencyScreen detergent panel with stability assays
Purification methodIMAC vs. affinity tags vs. ion exchangeDifferent methods yield varying purity and activityMulti-step purification strategy
Protein refoldingDirect extraction vs. inclusion body refoldingRefolding may yield higher amounts but lower activityCompare native extraction to refolding protocols

To reconcile contradictory findings, researchers should:

  • Document complete methodological details in publications, including seemingly minor variables like media composition and cell density at induction

  • Conduct side-by-side comparisons of different expression systems using the same protein construct

  • Validate protein functionality through multiple complementary assays rather than relying on a single readout

  • Confirm proper membrane insertion for functional studies using techniques like proteoliposome reconstitution

By systematically addressing these methodological variables, researchers can better understand the source of contradictory findings and establish reproducible protocols for HP_1130 expression studies.

How can HP_1130 research contribute to novel therapeutic approaches against H. pylori infection?

HP_1130 research offers several promising avenues for novel therapeutic development against H. pylori infection:

  • Small molecule inhibitors:

    • Structure-based drug design targeting HP_1130's active site or protein-protein interaction domains

    • High-throughput screening of compound libraries for specific inhibitors

    • Rational design of peptidomimetics that disrupt HP_1130 complexes

    • Development of allosteric inhibitors affecting conformational changes

  • Immunotherapeutic approaches:

    • Monoclonal antibodies targeting exposed epitopes of HP_1130

    • Vaccine components incorporating HP_1130 epitopes

    • Immunomodulatory strategies enhancing natural immune responses against HP_1130-expressing bacteria

  • Combination therapies:

    • HP_1130 inhibitors as adjuncts to current antibiotic regimens

    • Targeting multiple transport systems simultaneously to prevent compensatory mechanisms

    • Synergistic approaches targeting both HP_1130 and its interaction partners

  • Biofilm disruption strategies:

    • Compounds targeting HP_1130's role in biofilm formation

    • Combination with biofilm-penetrating antibiotics

    • Enzymes degrading biofilm components in concert with HP_1130 inhibition

Current H. pylori treatment faces challenges with antibiotic resistance and biofilm formation. The unique role of HP_1130 in bacterial survival and virulence makes it an attractive target for developing therapies that could overcome these challenges.

Early-stage research has demonstrated that targeting ExbB/D components can significantly reduce bacterial fitness in acidic environments and impair nutrient acquisition systems essential for colonization. These findings suggest that HP_1130-targeted therapies could provide alternative approaches to combat H. pylori infections resistant to conventional treatments.

What diagnostic applications could emerge from advanced understanding of HP_1130?

Advanced understanding of HP_1130 could lead to innovative diagnostic approaches for H. pylori infection:

  • Serological detection:

    • Development of enzyme-linked immunosorbent assays (ELISAs) detecting antibodies against HP_1130

    • Multiplex assays combining HP_1130 with other biomarkers for improved sensitivity and specificity

    • Lateral flow assays for rapid point-of-care testing

  • Molecular diagnostics:

    • PCR-based detection of HP_1130 gene variants associated with virulence or treatment resistance

    • CRISPR-Cas12/13-based detection systems targeting HP_1130 genetic signatures

    • Next-generation sequencing panels including HP_1130 for comprehensive strain typing

  • Functional diagnostics:

    • Metabolomic signatures associated with HP_1130 activity in gastric fluid

    • Breath test modifications detecting metabolites specific to HP_1130 function

    • Imaging agents targeting HP_1130 for endoscopic visualization

  • Predictive diagnostics:

    • HP_1130 variant analysis to predict treatment outcomes

    • Risk stratification for gastric cancer based on HP_1130-associated virulence profiles

    • Personalized treatment selection guided by HP_1130 status

Current H. pylori diagnostic methods include the urea breath test, stool antigen testing, serological tests, and invasive methods requiring endoscopy . None of these specifically target transport proteins like HP_1130.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.