Recombinant Helicobacter pylori Putative zinc metalloprotease HP_0258 (HP_0258)

Shipped with Ice Packs
In Stock

Description

Introduction to Helicobacter pylori HP_0258 Metalloprotease

Helicobacter pylori is a gram-negative bacterium that colonizes the human gastric mucosa and is associated with various gastrointestinal diseases, including gastritis, peptic ulcers, and gastric cancer. Among its virulence factors, metalloproteases play crucial roles in pathogenesis by facilitating bacterial colonization, immune evasion, and tissue damage. The putative zinc metalloprotease HP_0258 is one such factor identified in the Helicobacter pylori genome .

HP_0258 belongs to a class of proteins containing zinc-binding domains that coordinate zinc ions for catalytic activity. These metalloproteases typically function by hydrolyzing peptide bonds in target proteins, contributing to various physiological and pathological processes in bacterial metabolism and host-pathogen interactions. The recombinant form of this protein has been produced to facilitate detailed structural and functional studies that would otherwise be challenging with naturally occurring amounts in bacterial cells .

The significance of metalloproteases in Helicobacter pylori pathogenesis has been established through various studies, with these enzymes often contributing to bacterial survival in the harsh gastric environment. Helicobacter pylori produces metalloproteases that can be membrane-associated or secreted, with activities that help the bacterium establish persistent infection. Research has shown that such metalloproteases often display optimal activity at specific pH ranges and require metal cofactors for their function .

Historical Context and Discovery

The identification of metalloproteases in Helicobacter pylori emerged from studies investigating bacterial virulence factors. Early research demonstrated that Helicobacter pylori produces a metalloprotease with a native molecular size of approximately 200 kDa, as determined through size-exclusion chromatography . Subsequent genomic analyses identified several potential metalloprotease-encoding genes, including HP_0258, which was annotated as a putative zinc metalloprotease based on sequence homology with known metalloproteases from other bacterial species.

General Characteristics of Helicobacter pylori Metalloproteases

Helicobacter pylori metalloproteases typically demonstrate specific biochemical properties that contribute to their function. Research has shown that these enzymes often exhibit optimal activity at neutral to slightly alkaline pH values, with one characterized metalloprotease showing peak caseinolytic activity at pH 8.0 (37°C) . Their activities are characteristically inhibited by metal chelators such as ethylenediaminetetraacetic acid (EDTA) and 1,10-phenanthroline, confirming their metal-dependent nature .

Physical and Biochemical Properties

The recombinant form of HP_0258 is produced as a fusion protein with an N-terminal histidine tag to facilitate purification and detection . The protein is typically supplied in lyophilized powder form with greater than 90% purity as determined by sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE) . The storage buffer consists of Tris/phosphate-buffered saline (PBS)-based buffer with 6% trehalose at pH 8.0, which helps maintain protein stability during storage .

For reconstitution, the protein is recommended to be dissolved in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with the addition of 5-50% glycerol (typically 50% final concentration) for long-term storage at -20°C/-80°C . This formulation helps prevent protein degradation and maintains enzymatic activity during storage periods.

Expression and Purification Methods

The recombinant HP_0258 protein is expressed in Escherichia coli expression systems, which allow for high-yield production of the target protein . The His-tag fusion enables efficient purification through affinity chromatography, typically using nickel-nitrilotriacetic acid (Ni-NTA) resin or similar matrices that selectively bind histidine-tagged proteins.

Table 1 below summarizes the key specifications of the recombinant HP_0258 protein:

ParameterSpecification
SpeciesHelicobacter Pylori
SourceEscherichia coli
TagHistidine
Protein LengthFull Length (1-348 amino acids)
FormLyophilized powder
PurityGreater than 90% by SDS-PAGE
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
Recommended Storage−20°C/−80°C with glycerol (50%)
UniProt IDP56136

Enzymatic Activity and Substrate Specificity

While specific enzymatic characterization of HP_0258 is limited in the current literature, insights can be drawn from studies of other Helicobacter pylori metalloproteases. Zinc metalloproteases typically function by utilizing a zinc ion at their active site to catalyze the hydrolysis of peptide bonds in substrate proteins. The zinc ion is often coordinated by conserved amino acid residues, typically including histidine and glutamate or aspartate .

Metalloproteases from Helicobacter pylori have been shown to exhibit caseinolytic activity, with optimal function at specific pH ranges. For instance, a characterized metalloprotease demonstrated optimal activity at pH 8.0 and 37°C . The activity of these enzymes is typically inhibited by metal chelators such as EDTA and 1,10-phenanthroline, confirming their metal dependency .

Role in Bacterial Physiology and Pathogenesis

The putative zinc metalloprotease HP_0258 likely plays important roles in Helicobacter pylori physiology and pathogenesis. Metalloproteases in bacterial pathogens often contribute to virulence through various mechanisms, including degradation of host protective proteins, modification of bacterial surface proteins, and processing of signaling molecules.

Research on Helicobacter pylori metalloproteases has shown that some are associated with the outer membrane fraction of the bacterium and can also be secreted into the extracellular environment . This dual localization suggests potential roles in both bacterial cell surface remodeling and direct interaction with host tissues.

Interaction with Host Factors

Studies exploring the transcriptomic and metabolomic profiles in Helicobacter pylori infection have revealed complex interactions between bacterial metabolism and host immune responses . While specific interactions of HP_0258 with host factors are not directly described in the available literature, metalloproteases from bacterial pathogens often interact with components of the host extracellular matrix, immune system proteins, and cell surface receptors.

The potential relationship between metabolism and immune promotion during Helicobacter pylori infection suggests that metabolic enzymes, including metalloproteases, may contribute to modulating the tumor microenvironment in gastric cancer development . This highlights the importance of understanding the specific functions of proteins like HP_0258 in the context of Helicobacter pylori-associated diseases.

Relevance to Helicobacter pylori Pathogenesis

Understanding the function of HP_0258 contributes to the broader knowledge of Helicobacter pylori virulence mechanisms. The bacterium's ability to establish persistent infection in the human stomach and cause various gastrointestinal diseases depends on multiple virulence factors, including metalloproteases that may help the bacterium adapt to the harsh gastric environment and evade host immune responses.

Research on Helicobacter pylori infection has shown associations with metabolic alterations that may influence the tumor microenvironment in gastric cancer . The cross-talk between metabolism and immune promotion during Helicobacter pylori infection suggests that metabolic enzymes, potentially including metalloproteases like HP_0258, may play roles in disease progression beyond their direct enzymatic functions.

Potential Therapeutic and Diagnostic Applications

The detailed characterization of HP_0258 could lead to several potential applications:

  1. Development of specific inhibitors targeting the metalloprotease activity, which could serve as novel antibacterial agents against Helicobacter pylori

  2. Use as a biomarker for Helicobacter pylori infection or associated diseases

  3. Development of vaccines targeting this virulence factor

These applications would benefit from further research elucidating the specific roles of HP_0258 in Helicobacter pylori pathogenesis and its interactions with host factors.

Relationship to FlgZ (HP0958) and Other Zinc-Binding Proteins

While HP_0258 and HP0958 (FlgZ) are distinct proteins, both contain zinc-binding domains that contribute to their functions. FlgZ possesses a zinc-ribbon domain (DUF164) with two conserved CXXC motifs that coordinate a zinc ion . This domain is thought to interact with nucleic acids or proteins and plays a role in preventing the rapid turnover of RpoN (σ54), a transcription factor required for the expression of several flagellar genes in Helicobacter pylori .

Research has shown that replacing conserved cysteine residues in the CXXC motifs of FlgZ with serine greatly reduces RpoN levels, highlighting the importance of the zinc-ribbon domain in protein function . This suggests that the zinc-binding domains in Helicobacter pylori proteins, including potentially HP_0258, are crucial for their specific functional roles.

Comparison with Other Bacterial Metalloproteases

Metalloproteases are widely distributed among bacterial species, with varying functions related to physiology and pathogenesis. The distribution of DUF164 proteins (containing zinc-ribbon domains) and RpoN homologs in bacteria has been examined, revealing that these proteins are not universally distributed and appear to be absent in several major bacterial taxa .

Interestingly, in many bacteria that possess a DUF164 protein, genes encoding these proteins and RpoN are frequently found in the same genome, suggesting potential functional relationships . This comparative analysis provides context for understanding the specific roles of zinc-binding proteins like HP_0258 in Helicobacter pylori relative to similar proteins in other bacteria.

Evolutionary Perspectives

The evolutionary conservation of metalloproteases across bacterial species suggests their fundamental importance in bacterial physiology. In the case of zinc-binding domains, it is noteworthy that many of the DUF164 proteins in Actinobacteria and Bacteroidetes lack most or even all of the conserved cysteine residues typically found in these domains .

This variability in conservation patterns suggests evolutionary adaptations of zinc-binding domains to different functional requirements across bacterial taxa. Further comparative genomic and phylogenetic analyses would provide insights into the evolutionary history and functional diversification of metalloproteases like HP_0258 in Helicobacter pylori.

Knowledge Gaps and Future Research

Despite these insights, several knowledge gaps remain to be addressed through future research:

  1. Detailed enzymatic characterization of HP_0258, including substrate specificity and kinetic parameters

  2. Three-dimensional structure determination to elucidate the organization of the active site and substrate-binding regions

  3. Specific roles in Helicobacter pylori pathogenesis, including potential interactions with host factors

  4. Expression patterns during different stages of infection and under various environmental conditions

  5. Potential as a therapeutic target or diagnostic marker

Potential Impact on Helicobacter pylori Research

Further investigation of HP_0258 could significantly impact Helicobacter pylori research in several ways:

  1. Enhanced understanding of virulence mechanisms, particularly the roles of metalloproteases in bacterial adaptation and host-pathogen interactions

  2. Identification of novel targets for therapeutic intervention, potentially addressing the growing concern of antibiotic resistance in Helicobacter pylori

  3. Insights into the relationship between bacterial metabolism and host immune responses in the context of gastric diseases

The cross-talk between metabolism and immune regulation during Helicobacter pylori infection suggests that metabolic enzymes may serve as predictive biomarkers of survival outcomes and potential treatment targets for patients with Helicobacter pylori-induced gastric cancer . Understanding the specific contributions of proteins like HP_0258 to these processes would advance both basic and translational research in this field.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will fulfill your request as best as possible.
Lead Time
Delivery time may vary depending on the purchasing method or location. For specific delivery timelines, please consult your local distributor.
Note: All our proteins are shipped standard with blue ice packs. If you require dry ice shipment, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing it as per your specifications.
Synonyms
HP_0258; Putative zinc metalloprotease HP_0258
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-348
Protein Length
full length protein
Species
Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)
Target Names
HP_0258
Target Protein Sequence
MFIVAVLMLAFLIFVHELGHFTIARICGVKVEVFSIGFGKKLCFFKLFGTQFALSLIPLG GYVKLKGMDKEENGMNETTDDSYAQKSPFQKLWILFGGAFFNFLFAILVYFFLALGGEKV LLPVIGDLDKNALEAGLLKGDKILSINHKKIASFREIRSVVARARGELVLEIERNHQVLE KRLTPKIVAVISDSNDPNEMIRYKAIGIKPDMQKMGVVSYSLFQAFEKALSRFKEGVVLI VDSLRRLIMGSSSVKELSGVVGIVGALSHANSLSMLLLFGAFLSINLGILNLLPIPALDG AQMLGVVFKNIFHITLPTPIQNALWLAGVGFLVFIMFLGLFNDLTRLL
Uniprot No.

Target Background

Database Links
Protein Families
Peptidase M50B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.