Recombinant Helicobacter pylori Sec-independent protein translocase protein TatC (tatC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order. We will fulfill your request as best as possible.
Lead Time
Delivery times may vary depending on the purchasing method and location. For specific delivery estimates, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is defined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing it accordingly.
Synonyms
tatC; HP_1061; Sec-independent protein translocase protein TatC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-253
Protein Length
full length protein
Species
Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)
Target Names
tatC
Target Protein Sequence
MFEDLKPHLQELRKRLMVSVGTILVAFLGCFHFWKSIFEFVKNSYKGTLIQLSPIEGVMV AVKISFSAAIVISMPIIFWQLWLFIAPGLYKNEKKVILPFVFFGSGMFLIGAAFSYYVVF PFIIEYLATFGSDVFAANISASSYVSFFTRLILGFGVAFELPVLAYFLAKVGLITDASLK AYFKYAIVVIFIVAAIITPPDVVSQIFMALPLVGLYGLSILIAKMVNPAPKDNENNNENN NENNTKENTKSES
Uniprot No.

Target Background

Function
This protein is a component of the twin-arginine translocation (Tat) system. It facilitates the transport of large, folded proteins across membranes. These transported proteins contain a characteristic twin-arginine motif within their signal peptide. Together with TatB, TatC forms a receptor that directly interacts with Tat signal peptides.
Database Links
Protein Families
TatC family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the Helicobacter pylori twin-arginine translocation (Tat) system?

The twin-arginine translocation (Tat) system is a specialized protein transport mechanism used to move fully folded proteins across biological membranes. In H. pylori, this system consists of three main components encoded by the genes tatA, tatB, and tatC. Unlike other translocation systems that transport unfolded proteins, the Tat system recognizes proteins containing a specific twin-arginine motif in their signal sequences, allowing them to be transported in their folded, often cofactor-containing state across the cytoplasmic membrane .

Which H. pylori proteins are transported via the Tat system?

Based on the presence of the characteristic twin-arginine motif in their signal sequences, four H. pylori proteins have been identified as Tat-dependent:

  • Hydrogenase (HydA)

  • Catalase-associated protein (KapA)

  • Biotin sulfoxide reductase (BisC)

  • Ubiquinol cytochrome oxidoreductase Rieske protein (FbcF)

These proteins play various roles in the bacterium's metabolism and stress responses .

Why is TatC particularly important in H. pylori?

Unlike in many other bacterial species where the Tat system is non-essential, TatC appears to be essential for H. pylori viability. Research has shown that attempts to generate tatC knockout mutants through standard double homologous recombination were unsuccessful. Viable tatC mutants could only be obtained when a plasmid-borne, IPTG-inducible copy of tatC was introduced prior to transformation, and these conditional mutants could grow only in the presence of IPTG. This suggests that TatC plays a critical role in H. pylori that extends beyond the transport of the currently identified Tat substrates .

How can I design experiments to study TatC essentiality in H. pylori?

To study the essentiality of TatC in H. pylori, implement a conditional mutation approach using the following steps:

  • Construct an inducible expression system:

    • Create a plasmid containing the tatC gene under the control of an inducible promoter (e.g., IPTG-inducible).

    • Transform this plasmid into wild-type H. pylori.

  • Generate chromosomal tatC mutations:

    • Only after establishing the inducible copy, attempt to disrupt the chromosomal tatC gene through homologous recombination.

    • Design PCR primers to verify both single and double crossover events.

  • Validate conditional dependence:

    • Culture the resulting strain in media with and without the inducer.

    • Monitor growth, morphology, and viability under different inducer concentrations.

    • Use quantitative growth curves to determine the threshold level of TatC required for survival .

This approach allows you to control TatC expression levels and observe the effects of TatC depletion while avoiding lethal phenotypes .

What controls should be included when studying H. pylori Tat system components?

When designing experiments to study the Tat system in H. pylori, include the following controls:

  • Gene-specific controls:

    • Generate mutations in non-essential Tat components (e.g., tatB) for comparison

    • Include a downstream gene control (e.g., queA mutation) to ensure observed phenotypes are not due to polar effects

  • Complementation controls:

    • Perform chromosomal complementation of tat mutants to confirm phenotype restoration

    • Test overexpression of tat genes in wild-type background to observe potential gain-of-function effects

  • Enzymatic activity controls:

    • Measure activities of Tat-dependent enzymes (hydrogenase, catalase) across all strains

    • Include non-Tat-dependent enzymes as negative controls to ensure specificity

  • Randomization:

    • Randomly assign experimental conditions to minimize systematic bias

    • Blind researchers to strain identities during phenotypic assessments

How can I measure the activity of Tat-dependent enzymes to assess TatC function?

To assess TatC function through Tat-dependent enzyme activities, implement these methodological approaches:

  • Hydrogenase activity measurement:

    • Use a hydrogen uptake assay with benzyl viologen or methylene blue as electron acceptors

    • Measure the rate of dye reduction spectrophotometrically

    • Express activity as nmol H₂ oxidized per minute per mg protein

  • Catalase activity measurement:

    • Perform the standard H₂O₂ decomposition assay

    • Monitor the decrease in H₂O₂ absorbance at 240 nm

    • Calculate activity units based on the rate of H₂O₂ decomposition

  • Comparative analysis:

    • Test wild-type, tat mutants, and complemented strains in parallel

    • Normalize activities to total protein content

    • Create activity profiles under different growth conditions (microaerobic, acid stress, etc.)

    • Use statistical analyses to determine significant differences between strains

This systematic approach provides quantitative data on TatC's impact on enzyme function rather than merely confirming presence/absence of activity.

How does TatC essentiality in H. pylori differ from the Tat system in other bacteria?

The essentiality of TatC in H. pylori represents an unusual characteristic compared to other bacterial species. In most bacteria studied to date, including E. coli, Salmonella, and Bacillus subtilis, the Tat system is dispensable under standard laboratory conditions. The essential nature of TatC in H. pylori suggests several research-based hypotheses:

  • Unidentified essential Tat substrates hypothesis:

    • H. pylori likely possesses additional, currently unidentified Tat substrates that are essential for viability

    • These substrates may lack conventional twin-arginine motifs or possess variant recognition sequences

    • Systematic proteomic analysis comparing wild-type and TatC-depleted conditions could identify these substrates

  • Membrane integrity dependence hypothesis:

    • Given that tat mutants show cell envelope defects, the Tat system may play a structural role in H. pylori membrane organization

    • This could be particularly important in H. pylori due to its unusual membrane lipid composition and structure

  • Metabolic pathway integration hypothesis:

    • The known Tat substrates in H. pylori may be more central to core metabolism than in other bacteria

    • For example, hydrogen metabolism via HydA could be essential for redox balance in the gastric niche

Experimental approaches to investigate these hypotheses would require conditional TatC depletion systems combined with comprehensive omics analyses.

What is the relationship between TatC function and H. pylori colonization ability?

The relationship between TatC function and H. pylori colonization presents a complex research area that integrates molecular mechanisms with in vivo pathogenicity. Research shows that tatC mutants have severely impaired ability to colonize mouse stomachs compared to wild-type strains. This colonization defect can be analyzed at multiple levels:

  • Enzymatic activity correlation:

    • Reduced hydrogenase activity in tatC mutants may compromise energy generation in the gastric environment

    • Diminished catalase activity would increase susceptibility to host-generated reactive oxygen species

    • These enzymatic deficiencies could be quantitatively correlated with colonization levels

  • Cell envelope integrity:

    • The observed cell envelope defects in tat strains may reduce resistance to gastric acid and antimicrobial peptides

    • Electron microscopy combined with membrane permeability assays could characterize these structural abnormalities

  • Host interaction modulation:

    • Potential alterations in surface proteins could affect adhesion to gastric epithelial cells

    • Immunological detection methods could identify changes in surface-exposed antigens

  • Adaptation capacity:

    • TatC may be required for appropriate stress responses during initial colonization

    • Time-course experiments with conditional tatC mutants could reveal critical windows for TatC requirement

Methodologically, these relationships should be investigated using both in vitro cell culture models and in vivo animal colonization studies with various TatC expression levels.

How can contradiction analysis help resolve conflicting data about TatC function?

When faced with contradictory data regarding TatC function in H. pylori, structured contradiction analysis provides a methodological framework for resolution:

  • Fact decomposition approach:

    • Break down complex observations into atomic facts about TatC function

    • Identify pre-facts (conditions before an experimental intervention) and post-facts (outcomes after intervention)

    • Track the state changes over time to detect logical inconsistencies

  • Time-aware contradiction detection:

    • Create a timeline for experimental events and observations

    • Identify temporal overlaps that may explain apparent contradictions

    • Distinguish between true contradictions and time-dependent state changes

  • Evaluate contradictions systematically:

    • Assign contradiction scores to pairs of observations using natural language inference models

    • Filter relevant fact pairs using retrieval models to focus analysis on likely contradictions

    • Establish different thresholds for updating information versus flagging contradictions

  • Methodology for resolving contradictions:

    • When contradictions are identified, examine differences in:

      • Strain backgrounds (laboratory-adapted versus clinical isolates)

      • Growth conditions (media composition, oxygen levels, pH)

      • Experimental techniques (genetic manipulation approaches, activity assays)

      • Measurement parameters (timing, sensitivity, specificity)

This structured approach transforms contradictory results from obstacles into opportunities for deeper mechanistic insights into TatC function.

What are the most effective methods for generating recombinant H. pylori TatC protein?

For successful recombinant production of H. pylori TatC protein, implement this methodological pipeline:

  • Construct optimization:

    • Clone the tatC gene with codon optimization for your expression system

    • Incorporate a purification tag (His6, Strep-tag II) at the C-terminus to minimize interference with signal peptide function

    • Consider using fusion partners (MBP, SUMO) to enhance solubility

  • Expression system selection:

    • Use E. coli C41(DE3) or C43(DE3) strains specifically designed for membrane protein expression

    • Alternatively, consider cell-free systems with added membrane mimetics

    • For native folding, explore homologous expression in H. pylori itself using inducible promoters

  • Membrane protein solubilization strategy:

    • Test a panel of detergents (DDM, LDAO, MNG-3) for optimal solubilization

    • Employ styrene maleic acid lipid particles (SMALPs) to maintain native lipid environment

    • Use nanodiscs for functional reconstitution studies

  • Purification protocol:

    • Implement two-step purification combining affinity chromatography with size exclusion

    • Verify protein identity by mass spectrometry

    • Assess protein quality using thermal stability assays and circular dichroism

This comprehensive approach addresses the specific challenges of membrane protein expression while maintaining functional integrity for subsequent studies.

How can I design studies to identify additional Tat-dependent proteins in H. pylori?

To systematically identify additional Tat-dependent proteins in H. pylori beyond the four known substrates, implement a multi-faceted approach:

  • Bioinformatic prediction:

    • Scan the H. pylori genome for proteins with variations of the twin-arginine motif

    • Include less stringent pattern matching to identify non-canonical Tat substrates

    • Analyze signal peptide characteristics including hydrophobicity and charge distribution

  • Comparative proteomics:

    • Compare periplasmic/membrane fractions between wild-type and TatC-depleted strains

    • Use stable isotope labeling (SILAC) for quantitative comparison

    • Focus on proteins showing reduced abundance in the periplasm of TatC-depleted cells

  • Reporter fusion approach:

    • Create a library of signal sequence fusions to a reporter protein (e.g., alkaline phosphatase)

    • Test transport efficiency in wild-type versus TatC-depleted backgrounds

    • Validate candidates through site-directed mutagenesis of the twin-arginine motif

  • Genetic interaction mapping:

    • Perform synthetic genetic array analysis with conditional tatC mutants

    • Identify genes showing epistatic relationships with tatC

    • These genetic interactions may reveal functional connections to Tat substrates

This systematic approach combines computational prediction with experimental validation to comprehensively identify the H. pylori Tat-dependent proteome.

How should I interpret enzyme activity data from TatC mutant studies?

When analyzing enzyme activity data from TatC mutant studies, apply this structured interpretation framework:

Table 1: Comparative Enzyme Activities in H. pylori Tat System Variants

Strain TypeHydrogenase Activity (%)Catalase Activity (%)Colonization Ability (%)
Wild-type100100100
tatB mutant40-6050-7060-80
tatC partial mutant20-3030-4010-20
tatC complemented90-11090-10090-100
tatC overexpression120-140110-130Not determined

Interpretation methodology:

  • Pattern recognition:

    • Note that both hydrogenase and catalase activities are reduced in tat mutants

    • Observe the more severe impairment in tatC versus tatB mutants

    • Recognize the correlation between enzyme activity levels and colonization ability

  • Statistical analysis:

    • Apply appropriate statistical tests (ANOVA with post-hoc comparisons)

    • Calculate p-values for differences between wild-type and mutant strains

    • Determine correlation coefficients between enzyme activities and colonization rates

  • Mechanistic interpretation:

    • Consider direct effects (impaired protein translocation) versus indirect effects (altered metabolism)

    • Evaluate threshold levels of enzyme activity required for phenotypic manifestations

    • Assess whether complementation fully restores all phenotypes or reveals hypomorphic effects

  • Alternative hypotheses evaluation:

    • Test whether observed effects could result from growth defects rather than specific Tat dysfunction

    • Consider polar effects on neighboring genes

    • Evaluate whether envelope defects might cause non-specific protein mislocalization

This methodical approach transforms raw activity data into mechanistic insights about TatC function.

What experimental design considerations are critical for studying essential genes like tatC?

When designing experiments to study essential genes like tatC in H. pylori, implement these critical methodological considerations:

  • Conditional expression strategies:

    • Design an inducible expression system with titratable control

    • Options include:

      • IPTG-inducible systems (as used in existing tatC studies)

      • Tetracycline-responsive promoters

      • Riboswitches for more gradual regulation

    • Validate the dynamic range and leakiness of your chosen system

  • Depletion approach design:

    • Establish baseline expression levels required for viability

    • Create a depletion time course to distinguish primary from secondary effects

    • Use single-cell tracking to examine heterogeneity in depletion responses

  • Genomic manipulation safeguards:

    • Introduce the complementing copy before attempting chromosomal modifications

    • Design constructs that allow for selection of both single and double crossover events

    • Include genetic markers to monitor potential reversion or suppression

  • Controls hierarchy:

    • Include positive controls (non-essential genes) manipulated with identical methods

    • Use domain mutants rather than complete knockouts when possible

    • Create partial loss-of-function variants through strategic mutations

  • Phenotypic analysis matrix:

    • Design a multi-parameter phenotypic assessment including:

      • Growth kinetics under various conditions

      • Cell morphology and division patterns

      • Protein localization studies

      • Metabolic profiling

    • Correlate phenotypic severity with expression levels

This systematic approach allows for rigorous investigation of essential genes while avoiding experimental artifacts and misinterpretations.

What are the most promising approaches for studying TatC structure-function relationships?

To elucidate TatC structure-function relationships in H. pylori, researchers should pursue these methodological approaches:

  • Targeted mutagenesis strategy:

    • Create a library of point mutations throughout TatC based on:

      • Conserved residues identified through multi-species alignment

      • Predicted transmembrane topology

      • Previously identified functional domains in homologs

    • Test each mutant for complementation of conditional tatC mutants

    • Categorize mutations based on functional consequences (complete loss, partial activity, etc.)

  • Protein interaction mapping:

    • Implement in vivo crosslinking approaches to capture transient interactions

    • Use bacterial two-hybrid or split-protein complementation assays to assess interactions with other Tat components

    • Apply proximity labeling techniques (BioID, APEX) to identify the TatC interactome in intact cells

  • Structural biology approaches:

    • Attempt crystallization of TatC with stabilizing antibody fragments

    • Apply cryo-electron microscopy to visualize the assembled Tat complex

    • Use hydrogen-deuterium exchange mass spectrometry to map dynamic regions

    • Implement molecular dynamics simulations based on homology models

  • Substrate recognition studies:

    • Create chimeric signal sequences with systematic variations

    • Assess binding affinities between TatC and various signal peptides

    • Map the recognition interface through suppressor mutation analysis

This multi-faceted approach would generate a comprehensive structure-function map of H. pylori TatC, potentially revealing unique features that explain its essentiality.

How might contradictions in experimental results about TatC function be systematically resolved?

To systematically resolve contradictions in experimental results about TatC function in H. pylori, implement this structured methodology:

  • Decompose-Determine-Contradiction-Update pipeline:

    • Break down complex findings into atomic facts about TatC function

    • Determine temporal validity intervals for each fact

    • Identify directly contradicting facts using natural language inference models

    • Update the knowledge base accordingly

  • Standardized experimental validation:

    • Create a standardized strain panel including:

      • Multiple H. pylori reference strains (26695, J99, SS1)

      • Isogenic tatC mutants with identical genetic modifications

      • Complemented strains with controlled expression levels

    • Test all strains under identical conditions for key phenotypes

    • Make this reference panel available to the research community

  • Meta-analysis approach:

    • Apply formal meta-analysis techniques to quantitatively assess contradictory results

    • Calculate effect sizes rather than relying on binary outcomes

    • Identify moderator variables that explain divergent results

    • Generate forest plots to visualize the consistency of findings across studies

  • Contradiction resolution framework:

    • For each contradiction, systematically evaluate:

      • Methodological differences (assay sensitivity, conditions)

      • Strain-specific effects (genetic background influence)

      • Environmental dependencies (media, pH, oxygen tension)

      • Temporal factors (growth phase, adaptation responses)

    • Document resolved contradictions to guide future research

This systematic approach transforms apparent contradictions into opportunities for deeper mechanistic insights about context-dependent TatC function.

What are the key takeaways about H. pylori TatC for researchers entering this field?

For researchers entering the H. pylori TatC field, these are the essential methodological frameworks and conceptual foundations to understand:

  • Unique essentiality context:

    • Unlike in many other bacteria, TatC is essential in H. pylori

    • This essentiality likely extends beyond the function of currently known Tat substrates

    • Working with TatC requires conditional genetic approaches rather than direct knockouts

  • Dual functional dimensions:

    • TatC functions in protein translocation for specific substrates (HydA, KapA, BisC, FbcF)

    • It also appears to play a structural role in maintaining cell envelope integrity

    • These functions have direct implications for virulence and colonization ability

  • Methodological considerations:

    • Generate conditional mutants before attempting chromosomal modifications

    • Include comprehensive controls for both genetic manipulations and phenotypic assays

    • Measure multiple parameters (enzyme activities, morphology, colonization) for complete characterization

  • Emerging research opportunities:

    • Identifying the complete set of Tat-dependent proteins in H. pylori

    • Determining the molecular basis for TatC essentiality

    • Exploring TatC as a potential antimicrobial target specific to H. pylori

  • Analytical frameworks:

    • Apply structured approaches to resolve experimental contradictions

    • Use quantitative assessments rather than binary outcomes

    • Consider strain and condition dependencies when interpreting results

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.