Recombinant Helicobacter pylori Uncharacterized membrane protein HP_1331 (HP_1331)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Helicobacter pylori Uncharacterized Membrane Protein HP_1331 (HP_1331)

Recombinant HP_1331 is a full-length, His-tagged membrane protein derived from Helicobacter pylori, a gram-negative bacterium linked to gastric diseases. Expressed in E. coli, this protein (UniProt ID: O25889) spans 228 amino acids (AA) and is marketed for research applications in microbiology, structural biology, and vaccine development. While its exact biological function remains uncharacterized, its membrane localization suggests potential roles in host-pathogen interactions or bacterial survival mechanisms.

Production and Purity

HP_1331 is expressed in E. coli using T7-based vectors, which can induce metabolic stress and inclusion body formation. Key production metrics include:

MetricSpecification
Purity>90% (SDS-PAGE verified)
FormLyophilized powder
BufferTris/PBS-based buffer with 6% trehalose, pH 8.0
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL); glycerol (5–50%) recommended for stability

Challenges in Production:
Recombinant protein synthesis in E. coli often causes growth inhibition due to transcriptional burden and inclusion body formation, particularly for membrane proteins. While HP_1331’s solubility profile is not explicitly described, H. pylori proteins with hydrophobic regions (e.g., transmembrane domains) frequently aggregate under standard conditions .

Research Context and Potential Applications

HP_1331’s uncharacterized status limits direct functional insights, but its classification as a membrane protein suggests roles in:

  • Pathogen-Host Interactions: H. pylori employs membrane proteins to colonize gastric mucosa and evade immune responses .

  • Stress Response: H. pylori relies on DNA repair systems (e.g., RuvABC, RecN) for survival under oxidative stress, though HP_1331’s involvement in these pathways remains unconfirmed .

Comparisons and Future Directions

While no peer-reviewed studies directly investigate HP_1331, analogous H. pylori membrane proteins (e.g., adhesins, efflux pumps) are critical for virulence. Further research could explore:

AreaPotential Focus
Structural AnalysisX-ray crystallography or cryo-EM to resolve transmembrane topology
Functional ScreensKnockout studies in H. pylori to assess colonization or stress tolerance
Vaccine DevelopmentTesting as a candidate antigen for H. pylori subunit vaccines

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order and we will fulfill them accordingly.
Lead Time
Delivery time may vary based on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference point.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us and we will prioritize its development.
Synonyms
HP_1331; Uncharacterized membrane protein HP_1331
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-228
Protein Length
full length protein
Species
Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)
Target Names
HP_1331
Target Protein Sequence
MHEFLKAFKDAFPHTISILLGYLLMGMTFGMLLVQQGYDYKVALFMSLFIYAGAVQFVAI TLLSAQASLMNVVIVSLLVNARQTCYALSMLDRFKNTKWRLPYLAHALTDETFALLNLYA PKEGVSEKDFIFSISLLNHSYWIFGSLVGSLVGSHFSFDTQGMEFVMTAIFIVLFMEQYK RTTNHKNAWLGIVIAVVCLALFGTEYFLLIALVLMVLALMLFRKQLEC
Uniprot No.

Target Background

Database Links
Protein Families
AzlC family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Helicobacter pylori HP_1331 protein?

HP_1331 is an uncharacterized membrane protein from Helicobacter pylori, a gram-negative, helix-shaped, microaerophilic bacterium belonging to the family Helicobacteraceae. The recombinant form typically encompasses amino acids 1-228 of the native protein. H. pylori was identified in 1982 by Australian scientists Barry Marshall and Robin Warren and is known to colonize the upper gastrointestinal tract of more than 50% of the global population. Infection with H. pylori is associated with a 10-20% lifetime risk of developing peptic ulcers and a 1-2% risk of stomach cancer .

How does HP_1331 relate to other H. pylori membrane proteins?

While specific comparative data for HP_1331 is limited, many H. pylori outer membrane proteins (OMPs) belong to the Hop family. These proteins typically fold into anti-parallel amphipathic β-sheets organized into a β-barrel structure, with β-sheet domains localizing to the membrane region. These domains are connected by short amino acid loops in the periplasmic region and longer loops in the extracellular region. HP_1331, as a membrane protein, likely shares some structural similarities with other H. pylori OMPs, though its specific classification and relation to the Hop family requires further characterization .

What expression systems are most effective for producing recombinant HP_1331?

For recombinant production of HP_1331, researchers can utilize several expression systems including Escherichia coli, yeast, baculovirus, or mammalian cell systems. The choice depends on research objectives and downstream applications. E. coli systems often provide high yields and cost-effectiveness for initial characterization studies, while mammalian expression systems may offer more appropriate post-translational modifications for functional studies. When expressing membrane proteins like HP_1331, specialized E. coli strains (such as C41/C43) and optimized protocols that address protein toxicity and inclusion body formation should be considered .

What purification strategies are recommended for recombinant HP_1331?

Purification of membrane proteins like HP_1331 presents significant challenges due to their hydrophobic domains. A methodological approach includes:

  • Initial extraction using appropriate detergents (e.g., n-dodecyl-β-D-maltoside or CHAPS)

  • Affinity chromatography utilizing His-tag or other fusion tags

  • Size exclusion chromatography for further purification

  • Quality assessment via SDS-PAGE and Western blotting

For HP_1331 specifically, it's worth noting that while the extracellular domains of some H. pylori OMPs have been successfully purified and crystallized, full-length OMPs from H. pylori have proven more challenging to purify in their native conformation .

How can researchers effectively analyze HP_1331 expression under different pH conditions?

Given that H. pylori must survive the acidic environment of the stomach, analyzing pH-responsive expression of membrane proteins is crucial. Based on methodologies used for similar H. pylori genes, researchers should consider:

Experimental StepMethodologyKey Considerations
Bacterial CultureGrowth at varying pH (e.g., pH 5.3 vs. neutral)Use buffered media to maintain stable pH
RNA ExtractionTRIzol or column-based methodsEnsure RNase-free conditions
Expression AnalysisRNA-seq or RT-qPCRInclude appropriate housekeeping genes as controls
ValidationWestern blottingUse specific antibodies against HP_1331
Data AnalysisCalculate fold changes and statistical significanceApply FDR correction for multiple testing

This approach has successfully identified numerous pH-responsive genes in H. pylori, as demonstrated in studies examining the ArsRS regulon, where certain membrane proteins showed significant upregulation or downregulation in response to acidic conditions .

What bioinformatic approaches are most valuable for predicting HP_1331 structure and function?

For uncharacterized membrane proteins like HP_1331, computational prediction represents a critical first step. A comprehensive bioinformatic analysis should include:

  • Sequence homology searches using BLAST and HHpred

  • Transmembrane domain prediction using TMHMM, Phobius, or TOPCONS

  • Secondary structure prediction via JPred or PSIPRED

  • Tertiary structure modeling using AlphaFold2 or Rosetta Membrane

  • Functional domain identification through InterProScan and Pfam

  • Molecular dynamics simulations to assess stability in membrane environments

When analyzing results, researchers should focus on conserved domains that might suggest functional similarities with characterized proteins, particularly within the context of bacterial membrane proteins involved in pathogenesis.

How can researchers experimentally determine the membrane topology of HP_1331?

Determining membrane protein topology is essential for understanding function. For HP_1331, researchers should consider a multi-method approach:

MethodTechnical ApproachInformation Gained
PhoA/LacZ Fusion AnalysisCreate reporter fusions at varying positionsIdentifies periplasmic vs. cytoplasmic domains
Cysteine Scanning MutagenesisSystematically replace residues with cysteineMaps accessible residues
Protease Protection AssaysLimited proteolysis of intact cells vs. membrane preparationsReveals exposed domains
Epitope TaggingInsert epitope tags at predicted loopsConfirms topology through accessibility studies
Cryo-EMSingle-particle analysis of purified proteinProvides 3D structural information

Like many H. pylori OMPs, HP_1331 likely possesses extracellular loops that may be involved in host interactions, periplasmic loops, and membrane-spanning β-sheets arranged in a barrel formation .

What experimental evidence supports or refutes potential functional roles of HP_1331?

While specific functional data for HP_1331 is limited in the provided sources, researchers investigating uncharacterized H. pylori membrane proteins typically examine:

  • Gene knockout/mutation studies to assess impact on bacterial survival, colonization, and virulence

  • Pull-down assays to identify interaction partners (both bacterial and host)

  • Adhesion assays to determine involvement in host cell attachment

  • Immunological studies to assess immunogenicity and potential as vaccine candidate

  • pH-responsive expression analysis to understand environmental regulation

Research on other H. pylori OMPs has revealed diverse functions including adhesion to host cells (BabA, SabA, HopQ), enhancement of virulence factor translocation (BabA, HopQ), and roles in inflammatory response induction (OipA) .

How might HP_1331 contribute to H. pylori colonization and persistence?

Based on known functions of characterized H. pylori membrane proteins, HP_1331 could potentially contribute to pathogenesis through several mechanisms:

  • Adhesion to gastric epithelial cells or extracellular matrix components

  • Evasion of host immune responses

  • Adaptation to the acidic gastric environment

  • Nutrient acquisition in the restrictive gastric niche

  • Biofilm formation and bacterial co-aggregation

H. pylori infection leads to a 10-20% lifetime risk of developing peptic ulcers and a 1-2% risk of acquiring stomach cancer. Additionally, H. pylori has been associated with colorectal polyps and colorectal cancer . Understanding the potential role of HP_1331 in these pathogenic processes could provide new insights into disease mechanisms and therapeutic approaches.

What techniques are most effective for studying HP_1331's role in host-pathogen interactions?

Investigating the role of HP_1331 in host-pathogen interactions requires sophisticated methodological approaches:

TechniqueMethodologyResearch Application
Yeast Two-HybridScreen for protein-protein interactionsIdentify host cell binding partners
Bacterial Two-HybridTest specific protein interactionsMap bacterial protein interactions
ELISA-Based Binding AssaysMeasure binding to purified host componentsQuantify binding affinities
Cell Adhesion AssaysAssess attachment to cultured gastric cellsDetermine adhesive properties
Immunofluorescence MicroscopyVisualize protein localization during infectionMap spatial distribution during infection
Animal Infection ModelsCompare wild-type vs. HP_1331 mutantsAssess in vivo relevance

Other H. pylori OMPs such as BabA bind to Lewis B antigens, while SabA interacts with sialyl Lewis X and A antigens. HopQ binds to CEACAM proteins, and AlpA/B interact with extracellular matrix components like collagen IV and laminin . Similar studies with HP_1331 could reveal its specific binding partners and functional roles.

What is the potential of HP_1331 as a vaccine candidate against H. pylori?

Evaluating HP_1331 as a vaccine candidate involves systematic investigation of several key factors:

  • Conservation across H. pylori strains to ensure broad protection

  • Surface exposure and accessibility to antibodies

  • Immunogenicity and ability to induce protective immune responses

  • Stability and manufacturability as a recombinant antigen

  • Efficacy in animal models of H. pylori infection

Recombinant H. pylori proteins are being researched for vaccine development, though it's important to note that such proteins are currently limited to research purposes and cannot be used directly on humans or animals without proper clinical trials and regulatory approval .

How can researchers address the experimental challenges of working with HP_1331?

Working with membrane proteins like HP_1331 presents several technical challenges that researchers can address through specialized approaches:

  • Protein aggregation issues: Utilize specialized detergents or nanodiscs to maintain native conformation

  • Low expression yields: Optimize codon usage and employ specialized expression strains

  • Purification difficulties: Develop tailored protocols with appropriate detergents and buffer conditions

  • Structural characterization challenges: Combine multiple techniques (NMR, X-ray crystallography, Cryo-EM)

  • Functional assay development: Design specific binding and activity assays based on bioinformatic predictions

While the extracellular domains of some H. pylori OMPs have been successfully purified and crystallized, the full-length versions remain challenging. Researchers might consider focusing initially on specific domains of HP_1331 before attempting work with the complete protein .

How does HP_1331 expression correlate with H. pylori virulence and clinical outcomes?

To investigate correlations between HP_1331 and clinical manifestations, researchers should consider:

  • Comparative genomics across clinical isolates from different disease states

  • Transcriptomic analysis of HP_1331 expression in various clinical isolates

  • Serological studies to assess antibody responses to HP_1331 in patients

  • Histological examination of HP_1331 expression in gastric biopsies

  • Correlation analyses between HP_1331 sequence variants and disease severity

H. pylori infections are associated with varying clinical outcomes, from asymptomatic colonization to peptic ulcers and gastric cancer. Understanding the role of specific proteins like HP_1331 in determining these outcomes represents an important research direction .

How should researchers interpret contradictory data regarding HP_1331 function?

When faced with conflicting experimental results regarding HP_1331's function, researchers should:

  • Critically evaluate methodological differences between studies

  • Consider strain-specific variations in HP_1331 sequence and expression

  • Assess contextual factors such as growth conditions and experimental models

  • Design validation experiments using multiple complementary approaches

  • Perform meta-analyses of available data using standardized criteria

Scientific literature often contains seemingly contradictory results for bacterial membrane proteins, particularly those that are multifunctional or whose activities are context-dependent. A systematic approach to resolving such discrepancies is essential for advancing understanding of HP_1331.

What statistical approaches are most appropriate for analyzing HP_1331 expression data?

For gene expression studies involving HP_1331, appropriate statistical methods include:

Statistical ApproachApplicationConsiderations
False Discovery Rate (FDR)Multiple hypothesis testingAccounts for multiple comparisons
Fold Change AnalysisExpression level comparisonShould be combined with statistical significance
ANOVAComparing multiple conditionsAppropriate for complex experimental designs
Correlation AnalysisIdentifying co-expressed genesHelps establish functional relationships
Principal Component AnalysisDimensionality reductionReveals patterns in complex datasets

For example, in pH-responsive gene expression studies, researchers typically calculate both fold changes and FDR-corrected p-values, as seen in studies of other H. pylori genes responding to acidic conditions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.