Recombinant Helicobacter pylori Uncharacterized MscS family protein HP_0415 (HP_0415)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization of Recombinant Helicobacter pylori Uncharacterized MscS Family Protein HP_0415

Recombinant Helicobacter pylori Uncharacterized MscS Family Protein HP_0415 (HP_0415) is a 623-amino-acid mechanosensitive channel (MscS) homolog expressed in Escherichia coli with an N-terminal His-tag . This protein belongs to the MscS family (TC 1.A.23), which is evolutionarily conserved across bacteria and archaea and plays roles in osmoregulation by gating ion channels under mechanical stress . Its UniProt ID is O25170, and its gene locus is designated HP_0415 in the H. pylori 26695 strain genome .

Role in H. pylori Pathophysiology

While HP_0415 remains uncharacterized functionally, MscS family proteins are critical for bacterial survival under osmotic stress . In H. pylori, such proteins may contribute to gastric colonization or virulence, though direct evidence for HP_0415 is limited . Notably, H. pylori secretes multiple proteins (e.g., VacA, CagA) to manipulate host cells, but HP_0415 has not been identified in secreted proteomes .

Mechanosensitive Channel Activity

MscS homologs form homo-oligomeric channels that open under membrane tension, preventing lysis during hypoosmotic shock . Structural modeling suggests HP_0415’s TMS3 acts as the pore-lining helix, analogous to MscL .

Applications in Biomedical Research

  • Antibiotic Target Exploration: MscS channels are potential targets for novel antimicrobials due to their role in bacterial stress response .

  • Structural Studies: HP_0415 serves as a model for studying MscS family architecture and gating mechanisms .

  • Vaccine Development: Recombinant HP_0415 could be evaluated as an antigen in H. pylori vaccine candidates, given the pathogen’s global health burden .

Challenges and Future Directions

  • Functional Characterization: No in vitro electrophysiological data confirm HP_0415’s channel activity.

  • Pathogenic Link: Further studies are needed to determine if HP_0415 contributes to H. pylori-associated diseases like gastritis or gastric cancer .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please include them in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Please note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1 and 1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life of our proteins is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have specific tag requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
HP_0415; Uncharacterized MscS family protein HP_0415
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-623
Protein Length
full length protein
Species
Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)
Target Names
HP_0415
Target Protein Sequence
MRLLLWWVLVLSLFLNPLRAVEEHETDAVDLFLIFNQINQLNQVIETYKKNPERSAEISL YNTQKNDLIKSLTSKVLNERDKIGIDINQNLKEQEKIKKRLSKSINGDDFYTFMKDRLSL DILLIDEILYRFIDKIRSSIDIFSEQKDVESISDAFLLRLGQFKLYTFPKNLGNVKMHEL EQMFSDYELRLNTYTEVLRYIKNHPKEVLPKNLIMEVNMDFVLNKISKVLPFTTHSLQVS KIVLALTILALLLGLRKLITWLLALLLDRIFEIMQRNKKMHVNVQKSIVSPVSVFLALFS CDVALDIFYYPNASPPKVSMWVGAVYIMLLAWLVIALFKGYGEALVTNMATKSTHNFRKE VINLILKVVYFLIFIVALLGVLKQLGFNVSAIIASLGIGGLAVALAVKDVLANFFASVIL LLDNSFSQGDWIVCGEVEGTVVEMGLRRTTIRAFDNALLSVPNSELAGKPIRNWSRRKVG RRIKMEIGLTYSSSQSALQLCVKDIKEMLENHPKIANGADSALQNVSDYRYMFKKDIVSI DDFLGYKNNLFVFLDQFADSSINILVYCFSKTVVWEEWLEVKEDVMLKIMGIVEKHHLSF AFPSQSLYVESLPEVSLKEGAKI
Uniprot No.

Target Background

Database Links
Protein Families
MscS (TC 1.A.23) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How does the HP_0415 protein function in the context of H. pylori physiology?

As a member of the MscS family, HP_0415 likely functions as an osmolyte emergency release valve that prevents bacterial lysis during sudden decreases in external osmolarity . This mechanosensitive channel would respond to membrane tension by opening to release osmolytes, thereby preventing cell rupture during osmotic downshift.

In the context of H. pylori physiology, this function may be particularly important as H. pylori colonizes the gastric mucosa, where it faces varying osmotic conditions. H. pylori is known to infect more than 50% of the world's population and is associated with peptic ulcers, stomach cancer, and potentially colorectal cancer . The ability to withstand osmotic stress through mechanosensitive channels likely contributes to the remarkable persistence of this pathogen in the human gastrointestinal tract.

What expression systems are most suitable for recombinant HP_0415 production and what are their comparative advantages?

Multiple expression systems can be employed for recombinant HP_0415 production, each with distinct advantages:

Expression SystemAdvantagesLimitationsTypical Yield
E. coliRapid growth, high yield, cost-effective, well-established protocolsLimited post-translational modifications, potential inclusion body formation10-100 mg/L
YeastEukaryotic post-translational modifications, secretion capabilityLonger expression time, complex media requirements5-50 mg/L
BaculovirusComplex eukaryotic modifications, proper folding of large proteinsTechnical complexity, higher cost, longer timeline1-10 mg/L
Mammalian CellMost authentic post-translational modificationsHighest cost, longest production time, technical complexity0.1-5 mg/L

For initial characterization studies, E. coli expression systems are typically employed due to their efficiency and simplicity . The MJF465 strain (ΔmscL::Cm, ΔmscS, ΔmscK::Kan) is particularly valuable for functional studies as it lacks endogenous mechanosensitive channels that might interfere with characterization .

When expressing HP_0415 in E. coli, the pB10b vector with the lacUV5 promoter provides controlled expression with IPTG induction (typically 1 mM) . The addition of a C-terminal 6×His-tag facilitates purification and detection via Western blot, though tag placement should be carefully considered to avoid interfering with function .

What are the critical parameters for optimizing recombinant HP_0415 expression yield?

Optimizing expression of recombinant HP_0415 requires careful consideration of several parameters:

A key methodological approach is to monitor growth curves with and without induction to assess potential toxicity of HP_0415 expression, as demonstrated in similar studies . This allows identification of conditions that balance protein expression with minimal impact on cell viability.

What are the most effective methods to assess mechanosensitive channel function of recombinant HP_0415?

Functional characterization of HP_0415 can be approached through several complementary methods:

  • Electrophysiological patch-clamp recording: Inside-out patches from giant spheroplasts expressing HP_0415 can be subjected to negative pressure to evaluate channel activity . The protocol involves:

    • Expressing HP_0415 in MJF429 or MJF465 strains

    • Growing cultures to OD₆₀₀ ~0.2 with 60 μg/ml cephalexin to produce filamentous cells

    • Inducing expression with 1 mM IPTG for 40 minutes

    • Spheroplast preparation using lysozyme digestion in 0.8 M sucrose buffer

    • Patch-clamp recording with precise pressure application

  • Osmotic downshock assays: Cell survival rates during hypoosmotic shock provide functional assessment of mechanosensitive channel activity . The ratio of colony-forming units before and after shock quantifies protection against lysis.

  • Gating threshold determination: The pressure ratio for gating (Pₛ/Pₗ) compares the activation threshold of HP_0415 to that of MscL (used as an internal standard) . This normalizes for patch-to-patch variations and enables comparative analyses across mutants or conditions.

  • Cysteine scanning mutagenesis: Systematic replacement of residues with cysteine can identify functional regions within transmembrane domains . This approach is particularly valuable for HP_0415 given its uncharacterized nature, allowing identification of critical residues for function.

How can researchers distinguish between the closed, open, and inactivated states of HP_0415?

Distinguishing between conformational states of mechanosensitive channels requires multiple approaches:

  • Electrophysiological signature analysis: Different states exhibit characteristic conductance levels, open probabilities, and response kinetics that can be measured through patch-clamp recordings .

  • State-specific crosslinking: Based on structural models, engineered cysteine pairs can form disulfide bridges or coordinate zinc ions in specific conformational states . For example, the study of E. coli MscS identified that crosslinking between N117 and N167 significantly decreases pressure-induced current, suggesting these residues are critical for normal gating .

  • Conformation-specific antibodies: Antibodies raised against peptides corresponding to specific regions can preferentially bind to and stabilize particular conformational states.

  • Molecular dynamics simulations: Computational methods can model the transitions between states, identifying key residues involved in gating mechanisms that can then be validated experimentally.

Based on studies of E. coli MscS, researchers should expect a three-state scheme for the functional cycle of HP_0415: closed, open, and inactivated states . The transitions likely involve straightening and buckling of the TM3b helix, with closure and desensitization depending on buckling near conserved glycine residues .

Which residues in HP_0415 should be prioritized for site-directed mutagenesis to understand structure-function relationships?

Based on studies of related MscS proteins, key regions for mutational analysis include:

  • Transmembrane domain TM3b: This region forms part of the channel pore and undergoes significant conformational changes during gating . Priority residues include:

    • Conserved glycines that may serve as hinges (homologous to G113 and G121 in E. coli MscS)

    • Asparagine residues that may form hydrogen bonding networks (similar to N117 in E. coli MscS)

    • Hydrophobic residues lining the pore that determine conductance properties

  • Cytoplasmic domain-transmembrane interface: The interaction between these domains is critical for channel function . In E. coli MscS, the interaction between N117 in TM3b and N167 in the cytoplasmic domain proved essential for normal gating .

  • Tension sensor regions: Typically involving the interface between the lipid bilayer and the first two transmembrane domains.

A systematic approach should begin with sequence alignment of HP_0415 with E. coli MscS to identify conserved residues, followed by generation of single substitution mutants. Western blotting should confirm similar expression levels before functional characterization through patch-clamp recording of gating thresholds .

What experimental design best elucidates the impact of mutations on HP_0415 function?

A comprehensive mutational analysis of HP_0415 should follow this methodological framework:

  • Parallel functional assays:

    • Patch-clamp electrophysiology to measure channel conductance and gating parameters

    • Growth assays comparing induced vs. non-induced cultures to assess protein toxicity

    • Osmotic downshock survival assays to evaluate protection against lysis

    • Protein expression and stability verification through Western blotting

  • Controls and normalization:

    • Internal controls using endogenous MscL channels to normalize pressure sensitivity (Pₛ/Pₗ ratio)

    • Wild-type HP_0415 as positive control

    • Empty vector as negative control

    • Multiple independent preparations (minimum n=3) to ensure reproducibility

  • Data analysis approaches:

    • Quantitative comparison of gating thresholds relative to wild-type

    • Statistical significance testing through appropriate methods (ANOVA, t-tests)

    • Structure-based interpretation using homology models

This approach has successfully identified critical residues in related MscS proteins, such as the finding that N117C and N167C mutants in E. coli MscS exhibited significantly reduced pressure sensitivity (Pₛ/Pₗ = 1.02 ± 0.08 and 0.97 ± 0.09, respectively) compared to wild-type (Pₛ/Pₗ = 0.64 ± 0.11) .

What criteria should be used to evaluate HP_0415 as a potential vaccine candidate against H. pylori?

Evaluation of HP_0415 as a vaccine candidate requires assessment of multiple parameters:

  • Immunogenicity profile:

    • Ability to elicit strong antibody responses (measured by serum IgG ELISA)

    • T-cell activation potential (through cytokine profiling and T-cell proliferation assays)

    • Mucosal immune responses (secretory IgA levels)

  • Conservation and exposure:

    • Sequence conservation across H. pylori strains

    • Surface accessibility for antibody recognition

    • Expression levels during infection

  • Protective efficacy:

    • Challenge studies in animal models

    • Reduction in bacterial colonization

    • Prevention of pathology

  • Safety parameters:

    • Absence of autoimmune cross-reactivity

    • Minimal inflammatory responses

    • No adverse effects in animal models

The development approach should be similar to that used for other H. pylori vaccine candidates, such as the adhesin protein HpaA, which has demonstrated strong immunogenicity across various adjuvants and dosage forms .

How can recombinant HP_0415 production be optimized specifically for vaccine applications?

Optimization of HP_0415 production for vaccine applications requires consideration of specific requirements:

  • Expression system selection: While E. coli systems may be sufficient for initial characterization, vaccine-grade protein may require expression in systems that ensure proper folding and minimal endotoxin contamination .

  • Purification strategy:

    • Multi-step purification to achieve >95% purity

    • Endotoxin removal procedures

    • Verification of native conformation

  • Stability enhancement:

    • Formulation with appropriate stabilizers

    • Lyophilization protocols if necessary

    • Accelerated stability testing

  • Scale-up considerations:

    • Culture media optimization using response surface methodology and artificial neural network models

    • Bioreactor parameters for consistent batch production

    • Quality control metrics for batch-to-batch consistency

  • Adjuvant compatibility testing:

    • Protein stability in the presence of various adjuvants

    • Maintenance of epitope accessibility

    • Enhanced immunogenicity without protein degradation

The systematic optimization process should follow the approach used for other H. pylori vaccine antigens, combining one-factor-at-a-time experiments with statistical design methods to identify optimal conditions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.