Recombinant Helicobacter pylori Uncharacterized protein HP_0920 (HP_0920)

Shipped with Ice Packs
In Stock

Description

Production and Validation

HP_0920 is produced via recombinant DNA technology, leveraging E. coli expression systems for high yield . Post-purification steps involve Ni-NTA affinity chromatography, yielding soluble proteins with >90% purity . Antigenicity assessments using ELISA and immunoblotting confirm reactivity with sera from H. pylori-infected patients, supporting its potential as a diagnostic or vaccine target .

Reconstitution Guidelines

  • Buffer: Tris/PBS-based buffer with 50% glycerol for long-term stability .

  • Concentration: 0.1–1.0 mg/mL in sterile water .

  • Stability: Avoid repeated freeze-thaw cycles; working aliquots stored at 4°C retain activity for one week .

Diagnostics

HP_0920 has been tested in ELISA kits to detect H. pylori antibodies in patient sera . While not yet validated for clinical use, its immunoreactivity aligns with trends observed in other H. pylori antigens like UreG and CagY, which show high specificity in serological assays .

Vaccine Development

Although direct evidence for HP_0920 in vaccines is limited, recombinant H. pylori proteins (e.g., UreG, M_r26000 OMP) have demonstrated protective efficacy in animal models . For example:

  • M_r26000 OMP: Reduced H. pylori colonization in immunized mice by 71.8% .

  • Oral Recombinant Vaccine: Phase 3 trials showed 71.8% efficacy in preventing H. pylori infection in children .

These studies suggest HP_0920 could be explored as a component of multi-antigen vaccines.

Comparative Analysis of Recombinant H. pylori Antigens

AntigenGeneFunctionDiagnostic/Vaccine UtilityReference
HP_0920HP_0920UncharacterizedPotential diagnostic marker
CagY/Cag7HP0527Type IV secretion systemLinked to gastric cancer progression
UreGureGNickel chaperone for ureaseHigh specificity in serodiagnosis
M_r26000 OMP-Outer membrane proteinVaccine candidate (71.8% efficacy)

Unresolved Questions and Future Directions

  • Functional Role: HP_0920’s contribution to H. pylori virulence or persistence is unknown. Knockout studies or structural analyses (e.g., crystallography) could clarify its role .

  • Clinical Validation: Large-scale serological studies are needed to assess HP_0920’s diagnostic accuracy compared to established antigens like UreG .

  • Vaccine Formulations: Combining HP_0920 with immunodominant antigens (e.g., CagY) may enhance protective responses .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for tailored fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
HP_0920; Uncharacterized protein HP_0920
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-230
Protein Length
full length protein
Species
Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)
Target Names
HP_0920
Target Protein Sequence
MALYDRANSRNAYAEDSLLRESELVSFVKTTYKFFAGSLLLATIGALLGLMNFQAVVQYK WVFFIAEIAAFFGLMFSKSKPGLNLFMLFAFTSLSGVTLVPLLGMVIAKAGLGAIWQALG MTTIVFGLMSVYALKTKNDLANMGKMLFIALIVVVVCSLINLFLGSPMFQVVIAGASAIL FSLYIAYDTQNIVKGMYDSPIDAAVSLYLDFLNVFISILQIIGIFSDRDT
Uniprot No.

Target Background

Database Links
Protein Families
BI1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is HP_0920 and why is it significant for Helicobacter pylori research?

HP_0920 (UniProt ID: O25578) is an uncharacterized protein from Helicobacter pylori, a Gram-negative, helix-shaped microaerophilic bacterium identified in 1982 by Barry Marshall and Robin Warren . While the specific function of HP_0920 remains largely unknown, studying uncharacterized proteins in H. pylori is significant because this bacterium infects more than 50% of the world's population and is associated with peptic ulcers, stomach cancer, and potentially colorectal cancer .

The methodological approach to determining significance involves:

  • Comparative genomics with other characterized proteins

  • Analysis of protein structure using bioinformatics

  • Expression studies during different growth phases and infection conditions

  • Knockout studies to observe phenotypic changes in bacterial virulence or survival

How should HP_0920 recombinant protein be stored and handled for optimal stability?

Based on available data, HP_0920 recombinant protein requires specific handling conditions to maintain stability and biological activity:

  • Storage: Store the protein at -20°C/-80°C upon receipt, with -80°C recommended for long-term storage. Aliquoting is necessary to avoid repeated freeze-thaw cycles .

  • Reconstitution:

    • Briefly centrifuge the vial prior to opening

    • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

    • Add glycerol to a final concentration of 5-50% (50% is standard recommendation)

    • Aliquot for long-term storage

  • Working conditions:

    • Working aliquots may be stored at 4°C for up to one week

    • Avoid repeated freeze-thaw cycles as they can denature the protein

    • The protein is maintained in Tris/PBS-based buffer with 6% Trehalose, pH 8.0

For experimental consistency, researchers should document and standardize handling protocols across experiments, including time from reconstitution to use, temperature conditions during experiments, and buffer compositions when diluting the protein.

What experimental controls should be included when working with recombinant HP_0920?

When designing experiments with recombinant HP_0920, proper controls are essential for result validation. A methodological approach to controls should include:

  • Negative controls:

    • Buffer-only conditions (Tris/PBS with 6% Trehalose, pH 8.0)

    • Irrelevant recombinant protein with similar size and tag

    • Heat-denatured HP_0920 (for activity assays)

  • Positive controls:

    • Well-characterized H. pylori protein with known function

    • Tagged protein with established detection parameters (for antibody validation)

  • Expression system controls:

    • E. coli-expressed proteins without H. pylori sequences

    • Control for His-tag effects using alternate tagged versions where possible

  • Experimental validation controls:

    • Technical replicates (minimum triplicate)

    • Biological replicates from independent protein preparations

    • Concentration gradient to establish dose-dependent effects

Statistical analysis should include appropriate tests based on experimental design, with randomized block designs helping to control for batch-to-batch variation .

What experimental design is optimal for elucidating the function of HP_0920?

As an uncharacterized protein, determining HP_0920's function requires a multi-faceted experimental approach. Based on principles of experimental design, a comprehensive strategy should include:

  • Bioinformatic analysis:

    • Sequence homology comparisons across bacterial species

    • Protein domain prediction and conserved motif identification

    • Structural modeling and docking simulations with potential interactors

  • Expression studies:

    • qRT-PCR to determine expression patterns under various growth conditions

    • RNA-seq to identify co-expressed genes in regulatory networks

    • Proteomic analysis to verify translation and post-translational modifications

  • Localization studies:

    • Immunofluorescence microscopy with anti-HP_0920 antibodies

    • Subcellular fractionation followed by Western blotting

    • GFP-fusion protein expression for live-cell imaging

  • Interaction studies:

    • Yeast two-hybrid or bacterial two-hybrid screens

    • Pull-down assays using His-tagged HP_0920

    • Crosslinking followed by mass spectrometry (XL-MS)

  • Functional studies:

    • CRISPR-Cas9 gene deletion or mutation

    • Phenotypic characterization of mutants

    • Complementation studies to confirm phenotype specificity

This experimental design follows the principles of true experimental research design with appropriate controls and variables , while employing statistical rigor to validate findings. The design should progress from correlative to causative evidence, with each stage building upon previous findings.

How can researchers address the challenges of studying membrane-associated properties of HP_0920?

The amino acid sequence of HP_0920 suggests membrane association, which presents specific methodological challenges. To address these challenges:

  • Membrane protein solubilization:

    • Test multiple detergents (DDM, CHAPS, digitonin) at varying concentrations

    • Evaluate nanodiscs or amphipols as alternatives to detergents

    • Consider membrane mimetic systems (liposomes, bicelles)

  • Expression systems optimization:

    • Compare expression in E. coli, yeast, baculovirus, and mammalian systems

    • Adjust induction conditions and growth temperature

    • Test fusion partners that enhance membrane protein folding

  • Structural analysis approaches:

    • Cryo-electron microscopy for near-native state visualization

    • X-ray crystallography with lipidic cubic phase crystallization

    • Solid-state NMR for membrane-embedded structural determination

  • Functional reconstitution:

    • Proteoliposome reconstitution for transport or channel activity studies

    • Planar lipid bilayer electrophysiology

    • Förster resonance energy transfer (FRET) for conformational studies

  • In silico approaches:

    • Molecular dynamics simulations of membrane insertion

    • Evaluation of lipid-protein interactions

    • Prediction of membrane topology using multiple algorithms

Researchers should document detailed protocols for reproducibility, as membrane protein studies are particularly sensitive to experimental conditions. Statistical experimental design approaches should be employed to systematically optimize conditions .

What are the most informative approaches to study potential interactions between HP_0920 and host cells?

Understanding how HP_0920 potentially interacts with host cells requires specialized methodological approaches:

  • Cell culture models:

    • Human gastric epithelial cell lines (AGS, MKN45, NCI-N87)

    • Primary gastric organoids

    • Co-culture systems with immune cells

  • Binding studies:

    • Flow cytometry with labeled recombinant HP_0920

    • Surface plasmon resonance with potential host receptors

    • Cell-based ELISA for binding quantification

  • Cellular response analysis:

    • Transcriptomics (RNA-seq) of exposed vs. unexposed cells

    • Phosphoproteomics to detect signaling pathway activation

    • Cytokine/chemokine profiling using multiplex assays

  • Functional consequences:

    • Cell migration and invasion assays

    • Apoptosis and cell cycle analysis

    • Epithelial barrier integrity measurements

  • In vivo validation:

    • Animal infection models comparing wild-type and HP_0920 mutant strains

    • Tissue-specific immunohistochemistry

    • In vivo imaging of fluorescently tagged strains

For statistical robustness, these experiments should employ true experimental design principles with randomization, appropriate controls, and sufficient replication . Results should be analyzed using multivariate methods to account for the complexity of host-pathogen interactions.

How can contradictory results in HP_0920 research be addressed through experimental design?

When confronted with contradictory results in HP_0920 research, a systematic approach to experimental design can help resolve discrepancies:

  • Standardization of materials:

    • Use consistent recombinant protein preparations (same expression system, purification method)

    • Validate antibody specificity through multiple approaches

    • Create standard reference materials where possible

  • Protocol harmonization:

    • Develop detailed standardized protocols

    • Control environmental variables (temperature, pH, ion concentration)

    • Standardize data collection timepoints and methods

  • Multi-laboratory validation:

    • Implement ring testing across different laboratories

    • Blind testing of samples and analysis

    • Pre-registered experimental protocols with defined outcomes

  • Statistical approaches:

    • Power analysis to ensure adequate sample size

    • Mixed-effects models to account for inter-laboratory variation

    • Meta-analysis of published studies

  • Methodological triangulation:

    • Use multiple complementary techniques to test the same hypothesis

    • Vary experimental conditions systematically to test robustness

    • Develop orthogonal assays that measure the same phenomenon through different mechanisms

This approach follows principles of statistical experimental design , particularly focusing on controlling sources of variability and systematic bias. By implementing these methodological strategies, researchers can determine whether contradictions arise from biological complexity, technical artifacts, or experimental design limitations.

What is the optimal experimental approach to investigate HP_0920's potential role in H. pylori pathogenesis?

To methodically investigate HP_0920's role in H. pylori pathogenesis, researchers should implement a comprehensive experimental approach:

Experimental PhaseMethodologiesExpected OutcomesStatistical Approaches
Gene expression profilingqRT-PCR, RNA-seqExpression patterns during infectionDifferential expression analysis
MutagenesisCRISPR-Cas9, allelic exchangeHP_0920 knockout and point mutantsPhenotypic comparison tests
Colonization studiesAnimal infection modelsColonization efficiency of mutants vs. wild-typeSurvival analysis, ANOVA
Host response analysisCytokine profiling, histopathologyInflammatory markers, tissue damageMultivariate analysis
Virulence factor interactionCo-immunoprecipitation, bacterial two-hybridProtein-protein interactionsNetwork analysis

Additional methodological considerations include:

  • Temporal dynamics: Assess HP_0920 expression and function at different stages of infection

  • Strain diversity: Compare HP_0920 sequence and function across clinical isolates with varying virulence

  • Host specificity: Evaluate effects in different model systems (cell lines, organoids, animal models)

  • Environmental factors: Test pathogenesis under varying pH, microbiome contexts, and nutrient availability

  • Therapeutic targeting: Evaluate HP_0920 as a potential drug or vaccine target through inhibition or neutralization studies

What purification strategies yield the highest quality recombinant HP_0920 for structural studies?

Obtaining high-purity HP_0920 for structural studies requires optimized purification strategies:

  • Expression optimization:

    • Test multiple expression systems (E. coli, yeast, baculovirus, mammalian cells)

    • Evaluate different E. coli strains (BL21(DE3), Rosetta, Origami)

    • Optimize induction conditions (temperature, IPTG concentration, duration)

  • Primary purification:

    • Immobilized metal affinity chromatography (IMAC) utilizing the His-tag

    • Optimize binding and elution conditions (imidazole gradient, pH)

    • Consider on-column refolding for inclusion body purification

  • Secondary purification:

    • Size exclusion chromatography to remove aggregates

    • Ion exchange chromatography for charge variant separation

    • Affinity chromatography with specific ligands if identified

  • Quality assessment:

    • SDS-PAGE and western blotting

    • Dynamic light scattering for homogeneity analysis

    • Mass spectrometry for sequence verification and post-translational modifications

    • Circular dichroism to confirm secondary structure

  • Stability optimization:

    • Screen buffer conditions using differential scanning fluorimetry

    • Test stabilizing additives (glycerol, trehalose, specific lipids)

    • Evaluate protein engineering approaches (surface entropy reduction, disulfide engineering)

Successful purification should aim for >95% purity with minimal aggregation and batch-to-batch consistency. Researchers should implement statistical design of experiments (DOE) to systematically optimize critical purification parameters .

What are the most effective approaches to generate antibodies against HP_0920 for research applications?

Developing effective antibodies against HP_0920 requires careful methodological consideration:

  • Antigen design strategies:

    • Full-length recombinant protein (may be challenging due to membrane domains)

    • Selected peptide epitopes from predicted surface-exposed regions

    • Recombinant fragments representing specific domains

    • KLH-conjugated synthetic peptides from multiple regions

  • Antibody generation platforms:

    • Polyclonal antibodies from rabbits or goats (broader epitope recognition)

    • Monoclonal antibodies using hybridoma technology (consistency)

    • Recombinant antibodies using phage display (no animals required)

    • Single-domain antibodies (nanobodies) for enhanced access to conformational epitopes

  • Screening and validation:

    • ELISA against the immunizing antigen

    • Western blotting against recombinant protein and H. pylori lysates

    • Immunoprecipitation to verify native protein recognition

    • Immunofluorescence microscopy with H. pylori cultures

    • Knockout/knockdown controls to verify specificity

  • Optimization strategies:

    • Affinity maturation for monoclonal antibodies

    • Cross-adsorption for polyclonal antibodies

    • Isotype selection for specific applications

    • Antibody engineering for specialized applications (bifunctional, labeled)

Validation should include statistical analysis of antibody performance across multiple batches and conditions. The experimental design should incorporate appropriate positive and negative controls to ensure specificity .

How can researchers develop a reliable quantitative assay for HP_0920 in biological samples?

Developing a quantitative assay for HP_0920 requires a methodical approach to ensure reliability and reproducibility:

  • Assay platform selection:

    • Sandwich ELISA (requires two non-competing antibodies)

    • Competitive ELISA (useful with limited epitope accessibility)

    • Western blot with densitometry

    • Mass spectrometry-based targeted proteomics (SRM/MRM)

    • Proximity ligation assay for in situ quantification

  • Assay development steps:

    • Generate standard curves using purified recombinant HP_0920

    • Determine limit of detection and quantification

    • Establish linear range of the assay

    • Validate spike recovery in relevant matrices (gastric tissue lysates, bacterial cultures)

    • Assess intra- and inter-assay variability

  • Optimization parameters:

    • Antibody concentrations and pairing (for sandwich formats)

    • Sample preparation methods (extraction buffers, detergents)

    • Blocking agents to minimize background

    • Incubation conditions (time, temperature)

    • Signal development and detection parameters

  • Validation criteria:

    • Specificity (using HP_0920 knockout controls)

    • Sensitivity (minimum detectable concentration)

    • Precision (coefficient of variation <15%)

    • Accuracy (80-120% recovery of spiked samples)

    • Robustness (stability across operating conditions)

Statistical considerations should include establishing appropriate calibration models, determining confidence intervals, and implementing quality control procedures . Method validation should follow guidelines such as those from ICH or CLSI for analytical procedures.

What computational approaches can predict potential functions of HP_0920 based on sequence and structural data?

Computational prediction of HP_0920 function can be approached through several complementary methodologies:

  • Sequence-based prediction:

    • BLAST and PSI-BLAST for homology detection

    • Hidden Markov Model profiles for remote homology detection

    • Identification of conserved domains using InterProScan

    • Analysis of genomic context and gene neighborhood

    • Coevolution analysis to identify functional partners

  • Structural prediction and analysis:

    • Ab initio structure prediction using AlphaFold or RoseTTAFold

    • Template-based modeling if structural homologs exist

    • Binding site prediction based on surface features

    • Molecular docking with potential substrates or interactors

    • Molecular dynamics simulations to study conformational dynamics

  • Functional annotation approaches:

    • Gene Ontology term prediction

    • Pathway membership prediction

    • Protein-protein interaction network analysis

    • Text mining of scientific literature for related proteins

    • Integration of -omics data sets (transcriptomics, proteomics, metabolomics)

  • Machine learning methods:

    • Support vector machines for function classification

    • Neural networks trained on known bacterial protein functions

    • Random forest models incorporating multiple feature types

    • Graph convolutional networks for interaction prediction

When implementing these approaches, researchers should use statistical validation methods including cross-validation, bootstrapping, and receiver operating characteristic (ROC) curve analysis to assess prediction quality . Results should be interpreted as hypotheses to guide experimental validation.

How can HP_0920 be effectively utilized in developing new diagnostic approaches for H. pylori infection?

HP_0920 has potential applications in H. pylori diagnostic development, which can be methodologically approached as follows:

  • Antigen-based detection methods:

    • Evaluate HP_0920 as a biomarker in patient samples

    • Develop lateral flow assays using anti-HP_0920 antibodies

    • Create multiplexed protein arrays incorporating HP_0920 with other H. pylori antigens

    • Design ELISA-based assays for quantitative measurement

  • DNA-based detection approaches:

    • Design specific primers for HP_0920 gene amplification

    • Develop qPCR assays targeting HP_0920 sequences

    • Incorporate HP_0920 in multiplex PCR panels

    • Explore LAMP (loop-mediated isothermal amplification) for point-of-care testing

  • Clinical validation process:

    • Compare with current gold standard methods (urea breath test, endoscopic biopsy)

    • Determine sensitivity and specificity in diverse patient populations

    • Assess test performance in different clinical scenarios (pre-treatment, post-eradication)

    • Evaluate potential interference factors

  • Implementation considerations:

    • Develop standardized sample collection and processing protocols

    • Establish quality control materials and procedures

    • Design algorithms for result interpretation and clinical decision-making

    • Address regulatory requirements for diagnostic validation

Statistical approaches should include receiver operating characteristic (ROC) analysis to determine optimal cut-off values, calculation of positive and negative predictive values in relevant populations, and assessment of correlation with disease severity . Experimental design should follow validated diagnostic test development frameworks .

What role might HP_0920 play in H. pylori vaccine development strategies?

Exploring HP_0920 as a potential vaccine component requires a systematic approach:

  • Antigenicity assessment:

    • Epitope mapping to identify immunogenic regions

    • B-cell epitope prediction algorithms

    • T-cell epitope analysis for MHC binding potential

    • Conservation analysis across H. pylori strains

    • Post-translational modification analysis

  • Immunization platform evaluation:

    • Recombinant protein formulations with various adjuvants

    • DNA vaccine encoding HP_0920

    • Viral vector delivery systems

    • Peptide-based vaccines targeting specific epitopes

    • Live-attenuated or whole-cell vaccines including HP_0920

  • Preclinical testing methodology:

    • Animal models (mice, ferrets, non-human primates)

    • Challenge studies with H. pylori infection

    • Antibody titer measurement and characterization

    • T-cell response assessment (proliferation, cytokine production)

    • Protection correlation studies

  • Adjuvant selection criteria:

    • Th1/Th17 response promotion capability

    • Mucosal immunity induction potential

    • Safety profile in preclinical models

    • Compatibility with HP_0920 antigen

A structured experimental design including control groups, dose-response assessment, and statistical power calculations is essential . Research should follow the FDA's guidance for vaccine development, including evaluation of cellular and humoral immunity, protection parameters, and safety endpoints.

How can researchers investigate the potential role of HP_0920 in antibiotic resistance mechanisms?

Investigating HP_0920's potential role in antibiotic resistance requires a comprehensive methodological approach:

  • Expression correlation studies:

    • Compare HP_0920 expression levels between resistant and sensitive strains

    • Measure expression changes following antibiotic exposure

    • Assess co-expression with known resistance genes

    • Analyze regulatory elements controlling HP_0920 expression

  • Genetic manipulation approaches:

    • Generate HP_0920 knockout strains and assess antibiotic susceptibility

    • Create HP_0920 overexpression systems to evaluate resistance phenotypes

    • Perform site-directed mutagenesis to identify functional domains

    • Complementation studies to confirm phenotype specificity

  • Mechanistic investigation methods:

    • Membrane permeability assays (if HP_0920 affects membrane properties)

    • Antibiotic accumulation studies (uptake/efflux)

    • Enzyme activity assays if HP_0920 modifies antibiotics

    • Interaction studies with known resistance proteins

  • Clinical correlation approaches:

    • Sequence HP_0920 in clinical isolates with varying resistance profiles

    • Perform genome-wide association studies (GWAS) linking HP_0920 variants to resistance

    • Longitudinal studies tracking HP_0920 changes during treatment failure

    • Meta-analysis of existing genomic data sets

  • Resistance reversal strategies:

    • Test HP_0920 inhibitors in combination with antibiotics

    • Evaluate anti-HP_0920 antibodies for sensitization effects

    • Investigate regulatory manipulation to downregulate HP_0920

This research should employ experimental design principles including appropriate controls, sufficient replication, and statistical analysis of minimum inhibitory concentration (MIC) data . A mixed-methods approach combining in vitro, in silico, and clinical studies will provide the most robust evidence.

What methodological approaches can effectively assess post-translational modifications of HP_0920?

Post-translational modifications (PTMs) of HP_0920 can be systematically investigated using these methodological approaches:

  • Mass spectrometry-based strategies:

    • Bottom-up proteomics with enrichment for specific PTMs

    • Top-down proteomics for intact protein analysis

    • Middle-down approaches for larger peptide fragments

    • Targeted MS methods (MRM/PRM) for quantification of specific modifications

    • Ion mobility separation for improved PTM characterization

  • Enrichment techniques for specific PTMs:

    • Phosphorylation: Metal oxide affinity chromatography (MOAC), IMAC

    • Glycosylation: Lectin affinity, hydrazide chemistry

    • Acetylation: Anti-acetyl lysine antibodies

    • Ubiquitination: Ubiquitin remnant motif antibodies

    • Lipidation: Click chemistry with metabolic labeling

  • Site-specific characterization:

    • Site-directed mutagenesis of potential modification sites

    • Expression of recombinant HP_0920 in systems with different PTM capabilities

    • Chemical labeling strategies for specific modifications

    • Antibodies against specific modified forms

  • Functional impact assessment:

    • Activity assays comparing modified and unmodified forms

    • Structural analysis to determine conformational effects

    • Interaction studies to identify PTM-dependent binding partners

    • Stability and half-life measurements

  • In vivo dynamics:

    • Pulse-chase experiments to track modification kinetics

    • Stimulus-response measurements following environmental changes

    • Comparison across growth phases and stress conditions

Statistical analysis should include appropriate methods for dealing with missing values in PTM data, false discovery rate control in database searches, and quantitative analysis of PTM stoichiometry . Experimental design should incorporate biological and technical replicates with appropriate controls for each PTM type.

How can researchers assess HP_0920's potential role in H. pylori adaptation to gastric environment?

Investigating HP_0920's role in H. pylori adaptation to the gastric environment requires a multi-faceted methodological approach:

  • Environmental stress response analysis:

    • Acid stress exposure with transcriptomic/proteomic profiling

    • Oxidative stress adaptation studies

    • Nutrient limitation response assessment

    • Temperature fluctuation adaptation

    • Host defense factor exposure (antimicrobial peptides, bile salts)

  • Genetic manipulation approaches:

    • HP_0920 knockout strain phenotyping under stress conditions

    • Complementation studies with wild-type and mutant variants

    • Controlled expression systems to evaluate dose-dependent effects

    • Reporter gene fusions to monitor expression dynamics

  • Structural and functional adaptations:

    • Membrane integrity assessments under varying pH

    • Proton flux measurements in wild-type vs. mutant strains

    • Protein stability and conformation studies at different pH values

    • Interaction studies with other adaptation proteins

  • In vivo assessment methods:

    • Animal models with pH monitoring in different gastric regions

    • Bacterial recovery and enumeration from different gastric niches

    • Competition experiments between wild-type and HP_0920 mutants

    • Histological analysis of bacterial localization in gastric tissue

  • Transcriptional regulation mechanisms:

    • Promoter analysis and transcription factor binding site identification

    • ChIP-seq to identify regulatory proteins

    • RNA-seq under varying environmental conditions

    • Single-cell analysis to assess population heterogeneity in expression

This research should employ experimental design principles from both true experimental and quasi-experimental approaches , with careful control of environmental variables and appropriate statistical analysis of survival and adaptation data. Time-course experiments are particularly important to capture adaptation dynamics.

How can systems biology approaches enhance our understanding of HP_0920's role in the H. pylori proteome?

Systems biology offers powerful methodologies to contextualize HP_0920 within the broader H. pylori cellular network:

  • Multi-omics integration strategies:

    • Correlation analysis between transcriptomics, proteomics, and metabolomics data

    • Network reconstruction incorporating HP_0920

    • Flux balance analysis to predict metabolic impacts

    • Protein-protein interaction mapping using high-throughput techniques

    • Integration of genomic variation with functional data

  • Network analysis methodologies:

    • Identification of HP_0920 within functional modules

    • Pathway enrichment analysis for HP_0920-associated networks

    • Centrality measures to assess network importance

    • Differential network analysis under varying conditions

    • Bayesian network inference to predict causal relationships

  • Mathematical modeling approaches:

    • Kinetic modeling of pathways involving HP_0920

    • Agent-based modeling of HP_0920's role in bacterial population dynamics

    • Constraint-based modeling to predict phenotypic consequences

    • Stochastic modeling to account for cellular heterogeneity

  • Data integration platforms:

    • Knowledge graphs incorporating literature-mined information

    • Pathway databases with HP_0920 annotation

    • Visualization tools for multi-dimensional data

    • Machine learning for predictive modeling of HP_0920 functions

  • Experimental validation strategy:

    • Targeted validation of predicted interactions

    • Phenotypic profiling of HP_0920 perturbations

    • Synthetic lethality screening to identify functional relationships

    • Conditional essentiality mapping across environmental conditions

This systems approach requires careful statistical design, including methods for dealing with high-dimensional data, multiple testing correction, and integration of heterogeneous data types . Researchers should employ both supervised and unsupervised machine learning methods to extract patterns from complex datasets.

What cutting-edge structural biology techniques can resolve HP_0920's molecular mechanism?

Advanced structural biology methodologies offer new opportunities to elucidate HP_0920's molecular mechanisms:

  • Cryo-electron microscopy approaches:

    • Single-particle analysis for high-resolution structure determination

    • Cryo-electron tomography to visualize HP_0920 in cellular context

    • Time-resolved cryo-EM to capture conformational dynamics

    • Subtomogram averaging for in situ structural analysis

    • Correlative light and electron microscopy for functional contextualization

  • Integrative structural biology methods:

    • Combining X-ray crystallography, NMR, and cryo-EM data

    • Small-angle X-ray scattering (SAXS) for solution structure

    • Mass photometry for native mass measurements

    • Cross-linking mass spectrometry for interaction mapping

    • Hydrogen-deuterium exchange mass spectrometry for dynamics

  • Advanced spectroscopic techniques:

    • Solid-state NMR for membrane-embedded structural analysis

    • EPR spectroscopy with site-directed spin labeling

    • Single-molecule FRET to detect conformational changes

    • Infrared spectroscopy for secondary structure analysis

    • Native mass spectrometry for complex stoichiometry

  • Computational structure biology integration:

    • Molecular dynamics simulations to study conformational flexibility

    • Enhanced sampling methods to explore energy landscapes

    • Integrative modeling platforms combining experimental constraints

    • Coarse-grained simulations for longer timescale dynamics

    • Quantum mechanics/molecular mechanics for catalytic mechanism studies

  • Time-resolved structural methodologies:

    • Time-resolved X-ray crystallography

    • Temperature-jump kinetics with structural readouts

    • Stopped-flow techniques coupled with structural methods

    • Microfluidic mixing devices for time-resolved structural biology

Statistical approaches should include ensemble modeling, Bayesian inference for structure determination, and proper error analysis in structural models . Experimental design should focus on capturing the physiologically relevant conformational states of HP_0920.

How can single-cell analysis methods advance our understanding of HP_0920 expression heterogeneity?

Single-cell methodologies offer unprecedented insights into the heterogeneity of HP_0920 expression within H. pylori populations:

  • Single-cell transcriptomics approaches:

    • scRNA-seq to profile transcriptional heterogeneity

    • Spatial transcriptomics to map expression in relation to host tissue

    • Live-cell RNA imaging using fluorescent probes

    • RNA velocity analysis to determine transcriptional dynamics

    • Trajectory inference to map cellular states

  • Single-cell proteomics methods:

    • Mass cytometry (CyTOF) with anti-HP_0920 antibodies

    • Single-cell Western blotting

    • Microfluidic antibody capture techniques

    • Proximity ligation assays at single-cell resolution

    • Emerging nanopore-based single-cell proteomics

  • Fluorescence-based approaches:

    • Reporter strains with fluorescent proteins linked to HP_0920 promoter

    • Single-molecule fluorescence in situ hybridization (smFISH)

    • Fluorescence correlation spectroscopy for concentration and diffusion

    • Fluorescence-activated cell sorting (FACS) with transcript-specific probes

    • Time-lapse fluorescence microscopy for temporal dynamics

  • Microfluidic and lab-on-chip systems:

    • Droplet microfluidics for high-throughput single-cell isolation

    • Microfluidic trapping arrays for time-course studies

    • Microdissection systems for targeted cell isolation

    • Organ-on-chip models integrating H. pylori with host cells

    • Single-cell cultivation platforms for lineage tracking

  • Computational and statistical analysis:

    • Dimensionality reduction techniques (t-SNE, UMAP)

    • Clustering algorithms to identify cell subpopulations

    • Differential expression analysis at single-cell level

    • Information theory measures for heterogeneity quantification

    • Pseudotime analysis for temporal ordering

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.