Recombinant Helicobacter pylori Uncharacterized protein HP_1330 (HP_1330)

Shipped with Ice Packs
In Stock

Description

Introduction to HP_1330

Helicobacter pylori, a gram-negative bacterium that colonizes the human stomach, affects approximately half of the world's population and is the primary cause of stomach cancer . This helical-shaped microorganism has evolved sophisticated mechanisms to thrive in the harsh gastric environment, including the expression of numerous proteins whose functions remain incompletely understood. Among these is the uncharacterized protein HP_1330, which has emerged as a subject of scientific interest.

HP_1330 is a small protein encoded within the H. pylori genome that appears in close genomic proximity to the heat shock protein gene dnaJ . While its precise function remains undetermined, research indicates potential involvement in stress response pathways that may contribute to H. pylori's remarkable ability to persist in the gastric niche. Understanding proteins like HP_1330 is essential for comprehending H. pylori's adaptive mechanisms and developing targeted therapeutic strategies.

The study of uncharacterized proteins such as HP_1330 represents a critical frontier in H. pylori research, as these proteins may reveal novel bacterial survival strategies and potential intervention targets. Current approaches include recombinant protein production for structural and functional analyses, transcriptional studies to understand expression patterns, and investigations into potential interactions with known virulence factors.

Recombinant Production and Purification

For research purposes, HP_1330 can be produced as a recombinant protein using heterologous expression systems. The most common approach involves expressing the full-length protein (amino acids 1-115) with an N-terminal histidine tag in Escherichia coli expression systems . This method facilitates purification through affinity chromatography and enables subsequent structural and functional studies.

The table below summarizes the key characteristics of recombinant HP_1330 protein:

ParameterDetails
Protein LengthFull Length (1-115 amino acids)
Expression SystemE. coli
Fusion TagN-terminal Histidine tag
FormLyophilized powder
Purity>90% (SDS-PAGE verified)
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
Recommended Storage-20°C/-80°C with aliquoting for multiple use
ReconstitutionDeionized sterile water (0.1-1.0 mg/mL) with 5-50% glycerol

The recombinant protein exhibits high purity (>90%) as determined by SDS-PAGE analysis, making it suitable for various experimental applications . Proper storage and handling procedures, including avoiding repeated freeze-thaw cycles, are essential for maintaining protein integrity and activity.

Genomic Organization and Operon Structure

Northern blot analyses have detected a monocistronic dnaJ transcript approximately 1.1 kb in length, but attempts to identify specific transcripts using riboprobes complementary to HP1330 and HP1331 have been unsuccessful . This raises questions about the transcriptional regulation and expression patterns of HP_1330, suggesting potential post-transcriptional regulation mechanisms or low transcript abundance.

Heat Shock Response and Expression Regulation

The genomic proximity of HP_1330 to dnaJ, a well-characterized heat shock protein gene, suggests potential involvement in H. pylori's stress response mechanisms. Research indicates that the dnaJ gene in H. pylori is heat-inducible, with increased mRNA levels observed following temperature shift from 37°C to 42°C . While direct evidence for HP_1330's heat inducibility is lacking, its association with the heat shock response pathway warrants further investigation.

Interestingly, unlike other heat shock genes in H. pylori that are regulated by known regulatory elements such as CIRCE (Controlling Inverted Repeat of Chaperone Expression) or HAIR (HspR-Associated Inverted Repeat), no obvious regulatory cis elements have been identified upstream of the dnaJ gene or its associated genes including HP_1330 . This suggests the potential existence of novel regulatory mechanisms controlling the expression of these genes.

Experimental Tools and Resources

The availability of recombinant HP_1330 protein enables diverse experimental approaches to investigate its structural and functional properties. Commercially available recombinant HP_1330 protein preparations, typically featuring N-terminal His tags, serve as valuable tools for biochemical and immunological studies .

These recombinant proteins can be utilized in:

  • Antibody production for immunodetection and localization studies

  • Protein-protein interaction experiments to identify binding partners

  • Enzymatic activity assays to explore potential functions

  • Structural studies using techniques such as X-ray crystallography or NMR

Potential Biological Significance

While definitive functional characterization of HP_1330 remains elusive, several hypotheses regarding its biological significance can be proposed based on available data:

Despite these potential functions, it must be emphasized that experimental validation is required to establish the precise biological role of HP_1330 in H. pylori physiology and pathogenesis.

Functional Characterization Approaches

Future research efforts should focus on elucidating the function of HP_1330 through comprehensive approaches that combine genetic, biochemical, and structural methodologies. Priority areas for investigation include:

  1. Gene inactivation studies to assess the impact of HP_1330 deletion on H. pylori growth, stress tolerance, and virulence.

  2. Transcriptomic and proteomic analyses to examine expression patterns under various environmental conditions and in different H. pylori strains.

  3. Structural determination using crystallography or cryo-electron microscopy to provide insights into potential functional domains.

  4. Identification of interaction partners that may reveal functional associations within cellular networks.

Therapeutic and Diagnostic Potential

Understanding the function of HP_1330 may open new avenues for H. pylori intervention strategies. If this protein proves essential for bacterial fitness or pathogenesis, it could represent a novel target for antimicrobial development. Additionally, if HP_1330 demonstrates immunogenic properties, it might serve as a component in diagnostic assays or vaccine formulations.

The bacterial helical shape has been established as crucial for H. pylori's ability to colonize the stomach . As research continues to delineate the molecular mechanisms that define this morphology, investigation into whether proteins like HP_1330 contribute to cell shape maintenance may yield important insights into bacterial persistence strategies.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
HP_1330; Uncharacterized protein HP_1330
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-115
Protein Length
full length protein
Species
Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)
Target Names
HP_1330
Target Protein Sequence
MLMHSILIILVIILTTYFTRIWPFMVFNAKNPPNDFVRYLGRALSCSVIGMLVIYCFKDI HILKPPYGINEITAFLSVILLHRIFKVFVLSITLPTILYMVLVQSHALEKAFFNP
Uniprot No.

Target Background

Database Links
Protein Families
AzlD/HI_1737/HP1330 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the Helicobacter pylori uncharacterized protein HP_1330?

HP_1330 is a full-length protein consisting of 115 amino acids derived from Helicobacter pylori. The protein is currently classified as "uncharacterized," indicating that its specific biological function has not been fully elucidated. The recombinant version is typically expressed in E. coli with an N-terminal His tag to facilitate purification. The protein has the UniProt ID O25888 and is encoded by the HP_1330 gene in the H. pylori genome .

How should recombinant HP_1330 be stored and handled in laboratory settings?

Recombinant HP_1330 protein is typically provided as a lyophilized powder and should be stored at -20°C/-80°C upon receipt. Working aliquots can be maintained at 4°C for up to one week. The protein is typically reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, it's recommended to add 5-50% glycerol (final concentration) and aliquot for storage at -20°C/-80°C. Repeated freeze-thaw cycles should be avoided to maintain protein integrity .

What expression systems are typically used for HP_1330 production?

Recombinant HP_1330 is most commonly expressed in E. coli expression systems. The protein coding sequence is typically optimized for E. coli codon usage to enhance expression levels. Similar to other H. pylori proteins, such as HpaA, the gene can be inserted into expression vectors like pET28a(+) for efficient production in E. coli BL21(DE3) strains .

What structural features of HP_1330 might suggest its potential function?

Based on the amino acid sequence analysis, HP_1330 demonstrates several notable structural characteristics:

Structural FeatureDescriptionPotential Functional Implication
Hydrophobic regionsMultiple hydrophobic amino acid stretchesPossible membrane association or transmembrane domains
N-terminal region (MLMHSILIILVIILTTYFTR)High concentration of hydrophobic residuesPotential signal peptide or membrane anchor
Central regionMixed hydrophobic/hydrophilic profilePossible protein-protein interaction domain
C-terminal regionMore hydrophilic characterMay be exposed to aqueous environment

These structural features suggest HP_1330 might function as a membrane-associated protein, potentially involved in cell surface interactions, transport, or signaling mechanisms. Further structural studies using techniques like circular dichroism, X-ray crystallography, or NMR spectroscopy would be necessary to confirm these predictions .

How might HP_1330 be involved in H. pylori pathogenesis?

While the precise function of HP_1330 remains uncharacterized, several hypotheses can be proposed based on pattern recognition and comparative analysis with other H. pylori proteins:

  • Membrane association: The hydrophobic regions suggest it may be membrane-associated, potentially contributing to bacterial adhesion, host-cell interaction, or maintenance of membrane integrity.

  • Environmental adaptation: Like other H. pylori proteins, HP_1330 might play a role in adaptation to the acidic gastric environment.

  • Immune evasion: Some uncharacterized H. pylori proteins have been found to modulate host immune responses.

Testing these hypotheses would require experimental approaches such as gene knockout studies, protein-protein interaction analyses, and in vitro and in vivo infection models .

What approaches can be used to identify potential binding partners or interactors of HP_1330?

Several methodological approaches can be employed to identify binding partners:

  • Pull-down assays: Similar to methods used for histone modification studies, biotinylated HP_1330 can be used as bait to capture interacting proteins from H. pylori lysates or host cell extracts .

  • Yeast two-hybrid screening: This system can identify protein-protein interactions through transcriptional activation of reporter genes.

  • Co-immunoprecipitation: Using antibodies against HP_1330 to precipitate the protein along with its binding partners from cell lysates.

  • Cross-linking mass spectrometry: This approach can capture transient interactions by chemically cross-linking proteins in close proximity before analysis.

  • Surface plasmon resonance: To quantitatively measure binding affinities between HP_1330 and candidate interacting proteins.

These methods should be used in combination for validation and to minimize false positives .

How can culture conditions be optimized for maximum yield of recombinant HP_1330?

Based on optimization strategies used for other H. pylori proteins, several parameters can be adjusted to enhance HP_1330 yield:

ParameterOptimization ApproachExpected Effect
Media compositionTest variations of nitrogen sources (tryptone, yeast extract) and carbon sources (glucose, glycerol)Improved protein expression levels
Induction conditionsVary IPTG concentration (0.1-1.0 mM) and induction temperature (16-37°C)Balance between expression rate and proper folding
Induction timingInitiate induction at different OD600 values (0.4-1.0)Maximize cell density while ensuring efficient expression
Post-induction timeTest different harvest times (2-24 hours)Optimize protein accumulation while minimizing degradation

A one-factor-at-a-time approach combined with statistical methods like Response Surface Methodology (RSM) and Artificial Neural Network (ANN) modeling can efficiently identify optimal conditions. For example, studies with other H. pylori proteins have shown that induction at lower temperatures (16-25°C) often improves solubility of membrane-associated proteins .

What are the most effective purification strategies for recombinant HP_1330?

Given that recombinant HP_1330 is typically expressed with an N-terminal His tag, a multi-step purification process is recommended:

  • Initial capture: Immobilized metal affinity chromatography (IMAC) using Ni-NTA or similar resin to capture the His-tagged protein.

  • Intermediate purification: Ion exchange chromatography based on the protein's predicted isoelectric point to separate from contaminants with similar affinity for IMAC.

  • Polishing step: Size exclusion chromatography (SEC) to achieve high purity and remove aggregates.

For membrane-associated proteins like HP_1330, addition of appropriate detergents (e.g., mild non-ionic detergents like DDM or CHAPS at 0.1-1%) during lysis and purification may improve solubility and yield .

How can the purity and integrity of purified HP_1330 be assessed?

Multiple complementary techniques should be used to verify the quality of purified HP_1330:

  • SDS-PAGE: To assess purity and confirm molecular weight (expected around 12-15 kDa for the protein plus His tag).

  • Western blot: Using anti-His antibodies to confirm identity.

  • SEC-HPLC: To evaluate homogeneity and detect aggregation or degradation.

  • Mass spectrometry: For precise molecular weight determination and potential post-translational modifications.

  • Circular dichroism: To verify proper secondary structure formation.

The protein should show >90% purity by SDS-PAGE analysis for most research applications, though higher purity may be required for structural studies or immunological experiments .

What approaches can be used to investigate the potential immunogenicity of HP_1330?

To assess whether HP_1330 could serve as a potential vaccine antigen similar to other H. pylori proteins like HpaA, several immunological experiments can be conducted:

  • Western blot analysis: Using sera from H. pylori-infected individuals to test recognition of recombinant HP_1330.

  • ELISA assays: To quantify antibody responses against HP_1330 in patient samples.

  • Animal immunization studies: Immunize mice with purified HP_1330 and measure:

    • Specific IgG production using ELISA

    • T-cell responses via cytokine profiling

    • Protection against H. pylori challenge

  • Epitope mapping: To identify immunodominant regions within HP_1330 using peptide arrays.

These approaches would help determine if HP_1330 has potential as a diagnostic marker or vaccine component .

How can gene knockout or silencing techniques be applied to study HP_1330 function in H. pylori?

To determine the role of HP_1330 in H. pylori biology and pathogenesis:

  • Homologous recombination: Replace the HP_1330 gene with an antibiotic resistance cassette.

  • CRISPR-Cas9 system: Generate precise deletions or modifications in the HP_1330 gene.

  • Antisense RNA: Express antisense RNA to reduce HP_1330 expression.

After generating knockout or knockdown strains, phenotypic analysis should include:

  • Growth curve analysis in various conditions

  • Biofilm formation capacity

  • Adherence to gastric epithelial cells

  • Acid resistance

  • Motility assays

  • Animal colonization studies

Complementation studies (reintroducing the wild-type gene) should be performed to confirm phenotypes are specifically due to HP_1330 loss .

How should researchers interpret variations in HP_1330 sequence across different H. pylori strains?

Sequence variation analysis of HP_1330 across H. pylori strains can provide insights into:

  • Conservation level: Highly conserved regions often indicate functional importance.

  • Polymorphic regions: May suggest adaptation to different hosts or environments.

  • Selective pressure: dN/dS ratio analysis can indicate if the protein is under positive, neutral, or purifying selection.

A comparative analysis framework should include:

Analysis TypeMethodExpected Outcome
Sequence alignmentMultiple sequence alignment (CLUSTAL, MUSCLE)Identification of conserved and variable regions
Phylogenetic analysisMaximum likelihood or Bayesian methodsEvolutionary relationships between variants
Structure predictionHomology modeling of variantsPotential functional impacts of variations
Population geneticsFST and other metricsEvidence of geographic clustering

Variations should be interpreted in the context of H. pylori strain geographic origin, associated disease outcomes, and host factors .

What bioinformatic approaches can predict potential functions of HP_1330?

A comprehensive bioinformatic analysis workflow for HP_1330 should include:

  • Sequence-based analysis:

    • BLAST and HMM searches for homology to characterized proteins

    • Motif scanning for functional domains

    • Signal peptide and transmembrane domain prediction

    • Subcellular localization prediction

  • Structure-based prediction:

    • Ab initio or homology-based 3D structure modeling

    • Molecular docking with potential interactors

    • Molecular dynamics simulations to predict flexibility and binding sites

  • Genomic context analysis:

    • Examination of neighboring genes

    • Co-expression patterns

    • Presence in specific genomic islands

  • Comparative genomics:

    • Conservation across bacterial species

    • Correlation with pathogenicity or host range

These computational predictions should guide experimental design but must be validated through wet-lab experiments .

What are the most promising research avenues for elucidating HP_1330 function?

Based on current knowledge and methodological capabilities, several research directions hold particular promise:

  • Structural biology approaches: Determining the 3D structure of HP_1330 through X-ray crystallography or cryo-EM would provide significant insights into potential function.

  • Systems biology integration: Combining transcriptomics, proteomics, and metabolomics data from wild-type and HP_1330 knockout strains to place the protein in cellular pathways.

  • Host-pathogen interaction studies: Investigating if HP_1330 directly interacts with host cell components using techniques like proximity labeling.

  • Comparative analysis with other pathogens: Identifying functional homologs in related bacteria could provide functional clues.

  • Evolution of HP_1330 in clinical isolates: Analyzing sequence variations in strains associated with different disease outcomes.

These approaches, combined with rigorous experimental validation, are likely to uncover the biological significance of this currently uncharacterized protein .

How might advances in structural biology techniques be applied to HP_1330 research?

Recent advances in structural biology offer new opportunities for studying proteins like HP_1330:

  • AlphaFold and similar AI tools: Can predict protein structures with increasing accuracy, potentially providing insights even before experimental structure determination.

  • Integrative structural biology: Combining multiple techniques (X-ray, NMR, cryo-EM, crosslinking-MS) to overcome limitations of individual methods.

  • Time-resolved structural studies: Capturing conformational changes upon interaction with potential binding partners.

  • In-cell structural studies: Examining protein structure in its native cellular environment.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.