Recombinant Helicobacter pylori UPF0093 membrane protein HP_1484 (HP_1484)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
HP_1484; Protoporphyrinogen IX oxidase; PPO
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-148
Protein Length
full length protein
Species
Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)
Target Names
HP_1484
Target Protein Sequence
MGFLNGYFLWVKAFHVIAVISWMAALFYLPRLFVYHAENAHKKEFVGVVQIQEKKLYSFI ASPAMGFTLITGILMLLIEPTLFKSGGWLHAKLALVVLLLAYHFYCKKCMRELEKDPTRR NARFYRVFNEAPTILMILIVILVVVKPF
Uniprot No.

Target Background

Function

This recombinant Helicobacter pylori UPF0093 membrane protein, HP_1484, catalyzes the oxidation of protoporphyrinogen IX to protoporphyrin IX. It plays a role in the biosynthesis of tetrapyrrole molecules such as heme. Importantly, it does not utilize oxygen or artificial electron acceptors like menadione or benzoquinone.

Database Links
Protein Families
UPF0093 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How should researchers approach the recombinant expression of HP_1484?

Researchers should consider several approaches for optimal expression of HP_1484:

  • Expression System Selection: E. coli has been successfully used as an expression host for recombinant HP_1484, as noted in the available product information . This system allows for N-terminal His-tag fusion to facilitate purification.

  • Vector Design: When designing expression vectors, researchers should consider:

    • Appropriate promoter strength (typically IPTG-inducible for controlled expression)

    • Codon optimization for E. coli expression

    • Inclusion of appropriate fusion tags (His-tag is commonly used)

    • Signal sequences if membrane insertion is desired

  • Culture Conditions: Optimizing culture media components is critical for maximizing yield. Based on similar recombinant H. pylori proteins, key factors include:

    • Glucose concentration

    • Yeast extract content

    • Nitrogen sources (e.g., NH₄Cl)

    • Calcium levels (CaCl₂)

    • Induction timing and temperature

  • Purification Strategy: A two-step purification process is typically recommended for high purity and homogeneity, which is critical for subsequent structural and functional studies .

What statistical optimization approaches should be used for maximizing recombinant HP_1484 production?

Based on successful optimization strategies for similar H. pylori recombinant proteins, researchers should implement a multi-phase statistical approach:

  • One-factor-at-a-time (OFAT) preliminary screening to identify key variables affecting expression.

  • Plackett-Burman factorial experiments to determine the significance of each medium component on protein yield.

  • Response Surface Methodology (RSM) to model the relationships between multiple variables and optimize conditions.

  • Artificial Neural Network coupled with Genetic Algorithm (ANN-GA) modeling for superior predictive accuracy. This approach has demonstrated a 93.2% increase in yield for similar H. pylori proteins compared to non-optimized media .

The statistical optimization workflow should follow this sequence:

Optimization PhasePurposeTypical Variables Considered
OFAT ScreeningInitial parameter identificationTemperature, inducer concentration, media components
Plackett-Burman DesignIdentify significant factors6-12 media components simultaneously
Response Surface MethodologyModeling interactions3-5 most significant factors from previous step
ANN-GA ModelingFine-tuning for maximum yieldComplex interactions between significant variables

This approach has proven superior to traditional methods for recombinant protein production, with ANN-GA models showing better predictive accuracy than RSM alone .

How can researchers effectively evaluate the structural integrity of purified recombinant HP_1484?

Evaluating structural integrity of recombinant membrane proteins like HP_1484 requires multiple complementary approaches:

  • SDS-PAGE and Western Blotting: Initial purity assessment (>90% purity should be targeted) and confirmation of expected molecular weight .

  • Size-Exclusion Chromatography (SEC-HPLC): To assess protein homogeneity and detect potential aggregation.

  • Circular Dichroism (CD) Spectroscopy: To verify secondary structure elements consistent with membrane proteins.

  • Fourier-Transform Infrared Spectroscopy (FTIR): Particularly useful for analyzing transmembrane α-helical content.

  • Limited Proteolysis Combined with Mass Spectrometry: To probe the folding state and identify accessible regions.

For functional validation, researchers should consider reconstitution into liposomes or nanodiscs to maintain native-like membrane environments, followed by functional assays specific to the putative enzymatic activity (protoporphyrinogen IX oxidase) .

What approaches are recommended for studying HP_1484's membrane topology?

Investigating membrane topology of HP_1484 requires specialized techniques:

  • Computational Prediction: Begin with hydropathy analysis and transmembrane domain prediction algorithms (e.g., TMHMM, Phobius).

  • Experimental Verification:

    • Cysteine scanning mutagenesis followed by accessibility labeling

    • Epitope insertion at predicted loops with subsequent antibody accessibility testing

    • Protease protection assays to determine cytoplasmic vs. periplasmic exposure of domains

    • GFP-fusion analysis where GFP fluorescence indicates cytoplasmic localization

  • Crosslinking Studies: To identify interactions between transmembrane segments and potential oligomerization.

  • Cryo-EM or X-ray Crystallography: For high-resolution structural determination, though these are technically challenging for membrane proteins .

How should researchers design experiments to investigate the potential role of HP_1484 in H. pylori pathogenesis?

A comprehensive experimental design approach should include:

  • Gene Knockout Studies:

    • Generate HP_1484 deletion mutants in H. pylori

    • Assess growth in various conditions (pH stress, nutrient limitation)

    • Evaluate colonization efficiency in animal models

    • Compare virulence factor expression between wild-type and mutant strains

  • Host Interaction Studies:

    • Adhesion assays with gastric epithelial cell lines

    • Inflammatory response measurements (cytokine production)

    • Signal transduction pathway activation in host cells

    • Co-immunoprecipitation with potential host targets

  • Comparative Genomics:

    • Sequence analysis across H. pylori strains with different virulence profiles

    • Correlation of HP_1484 variants with clinical outcomes

  • Transcriptomic Analysis:

    • RNA-seq to determine if HP_1484 expression changes under infection-relevant conditions

    • Co-expression networks to identify functional relationships

This multi-faceted approach would provide comprehensive insights into whether HP_1484 contributes to H. pylori's ability to colonize the gastric environment and cause disease .

What methodologies are appropriate for exploring the potential of HP_1484 as a vaccine candidate?

Research exploring HP_1484 as a potential vaccine candidate should follow these methodological approaches:

  • Antigenicity Assessment:

    • Western blotting with sera from H. pylori-infected patients

    • ELISA to quantify antibody recognition

    • Epitope mapping to identify immunodominant regions

  • Immunogenicity Evaluation:

    • Animal immunization with purified recombinant HP_1484

    • Measurement of specific IgG responses by ELISA

    • Assessment of T-cell responses (proliferation, cytokine production)

    • Memory B-cell analysis

  • Protection Studies:

    • Challenge experiments in appropriate animal models

    • Quantification of bacterial load reduction

    • Histopathological assessment of gastric tissue

  • Adjuvant Optimization:

    • Testing various adjuvant formulations

    • Delivery system evaluation (e.g., nanoparticles, liposomes)

  • Cross-Protection Analysis:

    • Testing efficacy against diverse H. pylori strains

    • Sequence conservation analysis across clinical isolates

This approach aligns with successful strategies used for other H. pylori antigens like HpaA, which has shown promise as a vaccine candidate .

What are the common challenges in recombinant HP_1484 solubilization and how can they be addressed?

Membrane proteins like HP_1484 present specific challenges during solubilization and purification:

  • Inclusion Body Formation: Overexpression often leads to aggregation.

    • Solution: Optimize expression conditions (lower temperature, reduced inducer concentration)

    • Alternative: Develop refolding protocols from inclusion bodies using chaotropic agents followed by gradual dialysis

  • Detergent Selection: Critical for extracting the protein from membranes.

    • Approach: Screen multiple detergents (DDM, LDAO, OG, etc.) at various concentrations

    • Assessment: Evaluate protein activity and stability in each detergent

  • Protein Instability: Membrane proteins often destabilize outside their native environment.

    • Strategy: Include stabilizing agents (glycerol, specific lipids) in buffers

    • Advanced option: Consider using nanodiscs or amphipols for long-term stability

  • Purification Challenges:

    • Two-step protocol: Affinity chromatography followed by size exclusion

    • Buffer optimization: Maintain detergent above CMC throughout purification

    • Storage consideration: Lyophilization with trehalose (6%) has been shown effective for similar proteins

How can researchers address data inconsistencies when characterizing HP_1484 function?

When faced with inconsistent functional data for HP_1484, researchers should:

  • Validate Protein Integrity:

    • Verify proper folding using biophysical techniques (CD spectroscopy, thermal shift assays)

    • Confirm membrane integration in reconstituted systems

  • Control for Experimental Variables:

    • Standardize protein:lipid ratios in reconstitution experiments

    • Account for detergent effects on activity measurements

    • Ensure consistent buffer conditions (pH, ionic strength)

  • Consider Native Context:

    • Evaluate activity in the presence of potential binding partners

    • Test function under conditions mimicking the gastric environment

  • Statistical Approach:

    • Perform sufficient biological and technical replicates

    • Apply appropriate statistical tests for variability analysis

    • Consider Bayesian approaches for integrating multiple data sources

  • Reconciliation Strategies:

    • Develop a unified model that accounts for context-dependent functions

    • Design critical experiments to directly test competing hypotheses

    • Consider whether HP_1484 might have multiple functions depending on conditions

This systematic approach helps identify sources of variability and develop a coherent understanding of protein function .

How might HP_1484 research contribute to novel therapeutic approaches for H. pylori infection?

Research on HP_1484 could lead to therapeutic innovations through several pathways:

  • Target-Based Drug Design:

    • Structure determination could enable in silico screening for small molecule inhibitors

    • Rational design of peptide inhibitors targeting essential functional domains

    • Fragment-based drug discovery approaches focused on active site pockets

  • Vaccine Development:

    • Identification of immunodominant epitopes for subunit vaccine design

    • Evaluation of various adjuvant combinations for optimal immune response

    • Development of multivalent vaccines incorporating HP_1484 alongside other H. pylori antigens

  • Diagnostic Applications:

    • Development of serological tests based on recombinant HP_1484

    • Point-of-care diagnostics for H. pylori detection

    • Strain typing based on HP_1484 sequence variants

  • Fundamental Understanding:

    • Insights into membrane protein biology in H. pylori

    • Better understanding of bacterial adaptation to the gastric environment

    • Potential discovery of novel membrane protein functions

This research aligns with the recognized need for improved diagnostic tools and treatment strategies for H. pylori infection, which affects approximately half of the world's population and is associated with various gastric pathologies and extragastric complications .

What experimental design principles should guide studies comparing HP_1484 variants across H. pylori strains?

When designing comparative studies of HP_1484 across H. pylori strains, researchers should follow these principles:

  • Strain Selection Strategy:

    • Include strains from diverse geographical regions

    • Represent various clinical outcomes (asymptomatic, ulcer, gastric cancer)

    • Include reference strains with well-characterized genomes

  • Sequence Analysis Framework:

    • Perform multiple sequence alignment of HP_1484 homologs

    • Identify conserved domains and variable regions

    • Apply selection pressure analysis (dN/dS ratios)

    • Map variations to predicted functional domains

  • Experimental Variables Control:

    • Standardize expression and purification protocols across variants

    • Use identical assay conditions for functional comparisons

    • Include internal controls for normalization

  • Data Collection Matrix:

    • Create a comprehensive data table format:

Strain IDClinical SourceGeographic OriginKey HP_1484 VariantsExpression LevelFunctional ActivityHost Cell Response
Strain 1Gastric cancerEast AsiaVariant detailsMeasured valueMeasured valueMeasured value
Strain 2GastritisEuropeVariant detailsMeasured valueMeasured valueMeasured value
Strain 3AsymptomaticAfricaVariant detailsMeasured valueMeasured valueMeasured value
  • Statistical Analysis Plan:

    • Apply hierarchical clustering to identify strain groupings

    • Use principal component analysis to visualize relationship between variants

    • Implement correlation analysis between sequence variations and phenotypic data

    • Perform multivariate analysis to control for confounding factors

This structured approach enables robust comparisons and identification of clinically relevant variations in HP_1484 that might contribute to strain-specific virulence or adaptation mechanisms .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.