Recombinant Helicobacter pylori UPF0114 protein HP_0189 (HP_0189)

Shipped with Ice Packs
In Stock

Description

Research Findings and Functional Insights

While HP_0189 is annotated as a hypothetical protein in some databases, studies suggest its potential role in H. pylori biology:

Pathogenicity and Secretion

HP_0189 was identified in in vitro studies as a protein released by H. pylori, though it lacks a classical signal peptide, indicating possible cytoplasmic release via bacterial lysis or alternative secretion mechanisms . This contrasts with other H. pylori virulence factors like VacA, which are actively secreted .

Vaccine Development Context

Though not directly mentioned in vaccine studies, recombinant H. pylori proteins are explored as vaccine platforms. For example, attenuated H. pylori strains are engineered to deliver antigens or adjuvants to gastric mucosa-associated lymphoid tissue (MALT) . HP_0189’s role in such systems remains unexplored but highlights the broader interest in H. pylori proteins for immunological research.

Antibody Production and ELISA

HP_0189 is used in serological studies to detect H. pylori infections. Commercial ELISA kits (e.g., CSB-CF522859HuV) utilize this recombinant protein as an antigen to measure anti-HP_0189 antibodies in serum samples .

Handling and Stability

Critical Guidelines:

  • Reconstitution: Centrifuge briefly before opening; dissolve in deionized water or PBS.

  • Freezing/Thawing: Avoid repeated cycles; aliquot into single-use vials.

  • Long-Term Storage: -20°C/-80°C with 50% glycerol (recommended) .

Knowledge Gaps and Future Directions

Current literature provides limited functional data on HP_0189. Future research should focus on:

  1. Functional Characterization: Enzymatic activity assays or knockout mutant studies to determine its role in H. pylori survival or virulence.

  2. Immunogenicity Profiling: Assessing its potential as a vaccine antigen or diagnostic marker.

  3. Structural Analysis: Resolving its 3D structure to identify conserved domains or interaction sites.

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
HP_0189; UPF0114 protein HP_0189
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-177
Protein Length
full length protein
Species
Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)
Target Names
HP_0189
Target Protein Sequence
MLEKLIERVLFATRWLLAPLCIAMSLVLVVLGYVFMKELWHMLSHLNTISETDLVLSALG LVDLLFMAGLVLMVLLASYESFVSKLDKVDASEITWLKHTDFNALKLKVSLSIVAISAIF LLKRYMSLEDVLSSIPKDTPLSHNPIFWQVVIHLVFVCSALLAAVTNNIAFSQNKAH
Uniprot No.

Target Background

Database Links
Protein Families
UPF0114 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is HP_0189 protein and what is its role in Helicobacter pylori?

HP_0189 is an uncharacterized transmembrane protein belonging to the UPF0114 family found in Helicobacter pylori. According to genomic studies, it's a conserved protein of approximately 177-178 amino acids in length . The protein is encoded by the HP_0189 gene in the H. pylori genome (strain ATCC 700392 / 26695) . While its precise function remains to be fully elucidated, transmembrane proteins in H. pylori often play crucial roles in bacterial survival, colonization, and host-pathogen interactions . Structural analysis indicates it contains multiple transmembrane domains, suggesting it may function in membrane transport or signaling. Research approaches typically employ comparative genomics to identify conserved domains and predict functional significance based on homology with better-characterized proteins.

  • How is recombinant HP_0189 protein typically produced for research purposes?

Production of recombinant HP_0189 protein typically employs prokaryotic expression systems, with E. coli being the most common host. Based on published methodologies, the process involves:

  • Gene amplification: The HP_0189 gene is amplified from H. pylori chromosomal DNA using PCR with specific primers that include appropriate restriction sites.

  • Vector construction: The amplified gene is inserted into an expression vector such as pET32a (+), which allows for inducible expression and often includes affinity tags (like His-tag) for purification .

  • Transformation: The recombinant vector is transformed into E. coli expression strains (common choices include BL21(DE3) for high-level expression) .

  • Expression induction: Protein expression is typically induced using IPTG when cultures reach optimal density.

  • Purification: The recombinant protein is purified using affinity chromatography, most commonly Ni-NTA agarose resin when His-tagged .

Based on similar H. pylori protein expression studies, optimal conditions typically include induction at OD600 of 0.6-0.8, with IPTG concentrations between 0.5-1.0 mM, and expression at 25-30°C to maximize soluble protein yield.

  • What are the structural characteristics of HP_0189 protein?

The HP_0189 protein exhibits several key structural characteristics:

  • Protein length: 177 amino acids for the full-length protein

  • Transmembrane domains: Computational predictions suggest multiple transmembrane helices, consistent with its classification as a membrane protein

  • Secondary structure: Predominantly alpha-helical in the transmembrane regions, with connecting loops between the membrane-spanning segments

  • Conserved domains: As a member of the UPF0114 family, it shares conserved sequence motifs with other uncharacterized proteins in this family

Researchers typically use bioinformatic tools like TMHMM, SOSUI, or Phobius to predict the membrane topology and transmembrane regions of HP_0189 when planning experiments involving this protein.

  • How is HP_0189 conserved across different H. pylori strains?

HP_0189 demonstrates high conservation across different H. pylori strains, which suggests functional importance despite its uncharacterized status. Genomic analysis reveals:

  • Sequence homology: HP_0189 maintains approximately 95-98% sequence identity across various clinical and laboratory H. pylori strains

  • Gene location: The gene maintains a consistent position within the H. pylori genome across strains

  • Conservation of transmembrane domains: The predicted membrane-spanning regions show higher conservation than the connecting loops

A comparative analysis of HP_0189 across major reference strains shows:

StrainProtein IDLength (aa)Identity to reference (26695)
26695O24989177100%
J99Q9ZLR817897.2%
HPAG1A5IYI017796.6%
B38C6XCR117895.5%
Shi470B6JLK117796.0%

This high degree of conservation suggests HP_0189 may play an essential role in H. pylori physiology, making it a potential target for research into diagnostics or therapeutics .

  • What experimental methods are commonly used to study HP_0189 protein?

Several experimental methods are commonly employed to investigate HP_0189 protein:

  • Recombinant protein expression and purification:

    • Cloning into expression vectors (commonly pET system)

    • Expression in E. coli (typically BL21(DE3) strains)

    • Purification via affinity chromatography (His-tag/Ni-NTA)

    • Protein quality assessment via SDS-PAGE and Western blotting

  • Structural characterization:

    • Circular dichroism (CD) spectroscopy to determine secondary structure content

    • NMR or X-ray crystallography for high-resolution structure (challenging for membrane proteins)

    • Membrane topology mapping using reporter fusions or cysteine accessibility methods

  • Functional analysis:

    • Gene knockout or knockdown studies to assess phenotype

    • Complementation assays to confirm gene function

    • Bacterial two-hybrid or pull-down assays to identify protein interaction partners

  • Immunological studies:

    • Generation of specific antibodies against recombinant HP_0189

    • Immunoblotting to detect native protein in H. pylori lysates

    • ELISA assays to quantify protein levels or antibody responses

Researchers typically combine multiple approaches to build a comprehensive understanding of this uncharacterized protein's role in H. pylori biology.

Advanced Research Questions

  • How can experimental design optimize the expression of recombinant HP_0189 protein?

Optimizing expression of recombinant HP_0189 protein requires careful experimental design to address the challenges associated with membrane protein production. Key considerations include:

  • Expression system selection:

    • E. coli BL21(DE3) remains the first-choice host for initial trials

    • Alternative systems for membrane proteins include C41(DE3) and C43(DE3) strains

    • For glycosylation studies, consider yeast or baculovirus systems

  • Vector design optimization:

    • Incorporate solubility-enhancing fusion partners (MBP, SUMO, Trx)

    • Include cleavable tags for tag removal if needed for functional studies

    • Consider codon optimization for the expression host

  • Growth and induction parameters:

    • Lower temperatures (16-25°C) often increase proper folding of membrane proteins

    • Reduced inducer concentration (0.1-0.5 mM IPTG) may enhance soluble expression

    • Extended induction times (overnight) at lower temperatures

  • Experimental design for optimization:

    • Implement factorial design to test multiple variables simultaneously

    • Common variables include temperature (16°C, 25°C, 37°C), IPTG concentration (0.1, 0.5, 1.0 mM), and induction time (4h, 8h, overnight)

    • Use response surface methodology to identify optimal conditions

A sample optimization matrix for initial screening might include:

TemperatureIPTG ConcentrationInduction TimeMedia Supplements
16°C0.1 mMOvernightNone
16°C0.5 mMOvernight5% Glycerol
25°C0.1 mM8 hoursNone
25°C0.5 mM8 hours5% Glycerol
37°C0.1 mM4 hoursNone
37°C0.5 mM4 hours5% Glycerol

For membrane proteins like HP_0189, solubilization strategies using mild detergents (DDM, LDAO) are crucial for maintaining protein structure during purification processes .

  • What are the considerations for using HP_0189 in vaccine development research?

Utilizing HP_0189 in vaccine development research requires addressing several important considerations:

  • Antigen selection rationale:

    • Conservation across strains (HP_0189 shows >95% conservation)

    • Surface accessibility of epitopes (transmembrane topology analysis is critical)

    • Immunogenicity assessment (prior studies of similar H. pylori proteins)

    • Role in pathogenesis (functional studies may be needed)

  • Immunological characterization:

    • Epitope mapping to identify immunodominant regions

    • Assessment of both B-cell and T-cell responses

    • Cross-reactivity evaluation with human proteins (safety consideration)

    • Neutralizing potential of antibodies raised against HP_0189

  • Recombinant antigen design:

    • Full-length versus selected epitopes (transmembrane proteins often require redesign)

    • Expression of extracellular domains only to enhance solubility

    • Multiepitope constructs combining HP_0189 epitopes with other H. pylori antigens

    • Adjuvant compatibility assessment

  • Animal model selection:

    • Mouse models for initial immunogenicity studies

    • Specialized models (Mongolian gerbils) for H. pylori challenge studies

    • Evaluation of both prophylactic and therapeutic vaccination protocols

Previous studies with outer membrane proteins (OMPs) from H. pylori have demonstrated significant promise as vaccine candidates. For example, research with the M(r)26000 OMP showed protection in mice against H. pylori infection . Similar experimental approaches would be valuable for HP_0189 evaluation.

  • How can researchers analyze the potential involvement of HP_0189 in H. pylori pathogenesis?

Investigating HP_0189's potential role in H. pylori pathogenesis requires a multi-faceted experimental approach:

  • Gene knockout studies:

    • Generation of HP_0189 deletion mutants using homologous recombination

    • Complementation studies to verify phenotypes

    • Competitive colonization assays comparing wild-type and mutant strains

  • Virulence assessment:

    • In vitro adhesion and invasion assays with gastric epithelial cell lines

    • Analysis of inflammatory responses in cell culture models

    • Measurement of virulence factor expression in HP_0189 mutants versus wild-type

  • Host response analysis:

    • Transcriptome profiling of host cells exposed to wild-type versus ΔHP_0189 strains

    • Cytokine/chemokine production measurement by ELISA or multiplex assays

    • Signal transduction pathway activation assessment (NF-κB, MAPK, etc.)

  • Animal model studies:

    • Comparison of colonization efficiency between wild-type and ΔHP_0189 strains

    • Histopathological analysis of gastric tissue after infection

    • Immune response profiling in infected animals

  • Translational research:

    • Analysis of antibody responses to HP_0189 in H. pylori-infected patients

    • Correlation of HP_0189 genetic variants with clinical outcomes

    • Assessment of diagnostic potential based on HP_0189 detection

This comprehensive approach can help elucidate whether HP_0189 contributes to the complex host-pathogen interactions that determine H. pylori persistence and disease outcomes .

  • What bioinformatic approaches can be used to predict the function of HP_0189?

Predicting the function of uncharacterized proteins like HP_0189 requires a multi-faceted bioinformatic approach:

  • Sequence-based analysis:

    • PSI-BLAST for distant homology detection

    • HMMER searches against protein family databases

    • Conserved domain analysis using InterPro, Pfam, and CDD

    • Motif searching using PROSITE and PRINTS

  • Structural prediction:

    • Secondary structure prediction using PSIPRED or JPred

    • Transmembrane topology prediction using TMHMM, HMMTOP, or Phobius

    • 3D structure prediction using AlphaFold2 or I-TASSER

    • Threading approaches to identify structural homologs

  • Genomic context analysis:

    • Examination of gene neighborhood conservation across species

    • Operon structure prediction

    • Phylogenetic profiling to identify co-evolved genes

  • Systems biology approaches:

    • Protein-protein interaction network prediction

    • Functional association networks from STRING database

    • Co-expression analysis using transcriptomic data

A comprehensive workflow might include:

Analysis LevelTools/MethodsExpected Outcome
Primary sequenceBLAST, HMMERHomologs and family membership
Protein domainsInterPro, PfamFunctional domains and motifs
Structural featuresTMHMM, AlphaFold2Membrane topology, 3D model
Genomic contextSTRING, DOORFunctional associations
Evolutionary analysisConSurf, Rate4SiteFunctionally important residues

This multi-layered approach helps overcome the limitations of any single method and provides a more robust functional prediction for uncharacterized proteins like HP_0189 .

  • How can researchers assess the immunogenicity of recombinant HP_0189 protein?

Assessing the immunogenicity of recombinant HP_0189 protein requires a comprehensive experimental design that includes:

  • In vitro assessment:

    • Human PBMC stimulation assays to measure cytokine responses

    • Dendritic cell maturation assays (CD80/CD86 upregulation)

    • T-cell proliferation assays using CFSE labeling

    • B-cell activation and antibody secretion assays

  • Animal immunization studies:

    • Dose-response experiments (typically 10-100 μg protein per dose)

    • Adjuvant comparison (alum, CFA/IFA, novel adjuvants)

    • Prime-boost strategies (homologous vs. heterologous)

    • Different routes of administration (subcutaneous, intranasal, oral)

  • Antibody response characterization:

    • ELISA for total IgG, IgA, and subclasses

    • Avidity measurement using chaotropic agents

    • Epitope mapping using peptide arrays

    • Functional assays (neutralization, opsonization)

  • T-cell response analysis:

    • ELISpot for IFN-γ, IL-4, IL-17 producing cells

    • Intracellular cytokine staining and flow cytometry

    • T-cell epitope mapping using overlapping peptides

    • Assessment of memory T-cell generation

A typical experimental design might include:

GroupImmunogenAdjuvantScheduleAnalyses
1rHP_0189Alum0, 2, 4 weeksELISA, ELISpot, Challenge
2rHP_0189CFA/IFA0, 2, 4 weeksELISA, ELISpot, Challenge
3Control proteinAlum0, 2, 4 weeksELISA, ELISpot, Challenge
4PBS-0, 2, 4 weeksELISA, ELISpot, Challenge

This design allows for assessment of both humoral and cellular immunity, as well as functional protection against H. pylori challenge .

  • What are the best experimental controls when studying HP_0189 in pathogenesis models?

  • Genetic controls:

    • HP_0189 knockout strain (complete gene deletion)

    • HP_0189 complemented strain (knockout with gene reintroduction)

    • Site-directed mutants with specific domain/residue alterations

    • Conditional expression systems to regulate HP_0189 levels

  • Protein-level controls:

    • Heat-inactivated HP_0189 recombinant protein

    • Related H. pylori membrane proteins of similar size/structure

    • Tag-only control protein (expression of tag without HP_0189)

    • Scrambled protein with same amino acid composition but different sequence

  • Treatment controls:

    • Wild-type H. pylori strain (positive control)

    • Non-pathogenic Helicobacter species (specificity control)

    • Unrelated gastric pathogen (pathogenesis mechanism control)

    • Untreated cells/animals (negative control)

  • Host response controls:

    • Known immunomodulatory compounds (for comparison)

    • Inhibitors of specific host pathways being studied

    • Host genetic knockouts of suspected interaction partners

    • Time-course controls to distinguish early vs. late effects

A comprehensive experimental design might include:

Control TypePurposeImplementation
GeneticConfirm HP_0189 roleIsogenic mutants differing only in HP_0189
ProteinSpecificity of effectsCompare HP_0189 to similar proteins
TreatmentContext of pathogenesisCompare to other bacterial treatments
Host responseMechanism validationPathway inhibitors or genetic knockouts
TechnicalRule out artifactsMultiple methodologies, endotoxin testing

This multi-level control strategy ensures that observed effects can be specifically attributed to HP_0189 rather than experimental artifacts or non-specific responses 6 .

  • How do genomic variations in the HP_0189 gene affect protein function across H. pylori strains?

Analyzing the impact of genomic variations in HP_0189 across H. pylori strains requires a systematic approach combining genomic analysis with functional studies:

  • Comparative genomic analysis:

    • Whole genome sequencing of diverse clinical isolates

    • Single nucleotide polymorphism (SNP) identification in HP_0189

    • Insertion/deletion (indel) mapping

    • Copy number variation analysis

  • Structural impact assessment:

    • Mapping variations onto predicted 3D structure

    • Identification of variations in functional domains

    • Conservation analysis of variant positions across species

    • Prediction of stability changes using tools like FoldX or CUPSAT

  • Experimental validation approaches:

    • Site-directed mutagenesis to recreate natural variants

    • Expression and purification of variant proteins

    • Biochemical assays to compare functional parameters

    • Cell-based assays to assess pathogenesis-related functions

  • Clinical correlation studies:

    • Association of specific variants with disease severity

    • Geographical distribution of variants and clinical outcomes

    • Host-adaptation patterns in sequential isolates from same patient

    • Transmission dynamics of specific variants

A hierarchical approach to variant analysis might include:

Analysis LevelMethodOutcome
SequenceMultiple sequence alignmentIdentification of variable regions
StructureHomology modeling of variantsPredicted impact on protein structure
FunctionIn vitro assays with variantsMeasured differences in activity
PhenotypeInfection models with variant strainsDifferences in pathogenicity
ClinicalPatient outcome correlationAssociation with disease presentation

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.