Recombinant Helicobacter pylori UPF0114 protein HPAG1_0183 (HPAG1_0183)

Shipped with Ice Packs
In Stock

Description

Vaccine Development

HPAG1_0183 has been explored as a potential vaccine candidate due to its surface-exposed localization in H. pylori:

  • Subcutaneous immunization with recombinant H. pylori outer membrane proteins (OMPs) conferred 95% protection against bacterial challenge in murine models .

  • HPAG1_0183’s homology to other immunogenic OMPs (e.g., M r26000 OMP) suggests cross-reactive antigenicity, a critical feature for broad-spectrum vaccine design .

Diagnostic Assays

  • Recombinant HPAG1_0183 demonstrates high specificity (>90%) in serological assays when probed with sera from H. pylori-infected patients .

  • ELISA kits incorporating this protein (e.g., Creative BioMart Cat. No. RFL34854HF) are commercially available for detecting H. pylori antibodies .

Comparative Analysis with Other H. pylori Antigens

HPAG1_0183 belongs to a broader family of H. pylori antigens under investigation:

AntigenFunctionApplicationKey Reference
CagAType IV secretion system effectorVirulence marker
VacAVacuolating cytotoxinPathogenesis studies
UreGNickel-binding chaperoneDiagnostic reagent
HPAG1_0183UPF0114 family proteinVaccine/diagnostic development

HPAG1_0183 lacks direct association with known virulence systems (e.g., cagPAI or Tfs3/Tfs4 T4SSs) but shares structural features with conserved OMPs .

Technical Notes

  • Stability: Repeated freeze-thaw cycles degrade the protein; long-term storage requires aliquots at -80°C .

  • Reactivity: Recognized by polyclonal antibodies in immunoblotting and ELISA .

Genetic Diversity Considerations

H. pylori exhibits high genetic variability due to recombination and mutation . HPAG1_0183 sequences show strain-specific polymorphisms, necessitating region-specific antigen validation for diagnostic/therapeutic use .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate special requests. Please specify your desired format when placing your order, and we will fulfill it to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is necessary. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing it for your order.
Synonyms
HPAG1_0183; UPF0114 protein HPAG1_0183
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-177
Protein Length
full length protein
Species
Helicobacter pylori (strain HPAG1)
Target Names
HPAG1_0183
Target Protein Sequence
MLEKLIERVLFATRWLLAPLCIAMSLVLVVLGYVFMKELWHMLSHLDTISETDLVLSALG LVDLLFMAGLVLMVLLASYESFVSKLDKVDASEITWLKHTDFNALKLKVSLSIVAISAIF LLKRYMSLEDVLSSIPKDTPLSHNPIFWQVVIHLVFVCSALLAAVTNNIAFSQNKGH
Uniprot No.

Target Background

Database Links
Protein Families
UPF0114 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the known or predicted function of UPF0114 proteins in Helicobacter pylori?

UPF0114 proteins belong to the uncharacterized protein family 0114, indicating their function remains largely unknown. In H. pylori, HPAG1_0183 has not been definitively characterized functionally, but proteomic analyses of H. pylori have detected this protein and mapped some of its interactions . Systematic proteomic analyses have characterized approximately 70% of H. pylori proteins, with about 50% quantified in terms of copy numbers per cell .

Methodologically, researchers should approach functional characterization through:

  • Protein-protein interaction studies using pull-down assays with tagged HPAG1_0183

  • Gene knockout/knockdown experiments to observe phenotypic changes

  • Comparative expression analysis under different stress conditions

  • Structural homology modeling to predict function based on similar proteins

The relationship of this protein to H. pylori stress responses or persistence mechanisms represents a promising research direction, given the bacterium's remarkable adaptability to harsh gastric environments.

How does HPAG1_0183 relate to other characterized proteins in H. pylori?

Interactome studies have identified more than 3,000 protein-protein interactions in H. pylori, providing a framework for understanding functional relationships . While specific HPAG1_0183 interactions are not detailed in the available literature, researchers should consider its potential involvement in:

  • Membrane integrity and stress response pathways

  • Bacterial persistence mechanisms

  • Potential role in DNA repair networks, given H. pylori's high recombination rates

  • Possible involvement in the bacterium's ability to colonize the gastric mucosa

To methodically investigate these relationships, researchers should:

  • Perform co-immunoprecipitation experiments with HPAG1_0183 as bait

  • Analyze co-expression patterns across different environmental conditions

  • Conduct yeast two-hybrid screening to identify interaction partners

  • Compare phenotypes between wild-type and HPAG1_0183-deficient strains during colonization experiments

What expression systems are optimal for recombinant HPAG1_0183 production?

Multiple expression systems can be employed for HPAG1_0183 production, each with distinct advantages:

Expression SystemAdvantagesConsiderationsRecommended Use
E. coliHighest yield, rapid growth, cost-effective, established protocolsMay lack proper PTMs, potential inclusion body formationInitial structural studies, antibody production
YeastHigher eukaryotic PTMs, good secretion, moderate yieldLonger expression time, more complex mediaFunctional studies requiring some PTMs
Insect cellsAdvanced eukaryotic PTMs, proper foldingLonger setup time, higher cost, specialized equipmentComplex functional assays, structural biology
Mammalian cellsMost complete PTMs, native-like foldingHighest cost, lowest yield, specialized expertiseStudies requiring mammalian-specific modifications

For HPAG1_0183, E. coli expression has been successfully employed with N-terminal His-tag fusion . When utilizing E. coli, researchers should optimize expression conditions by testing:

  • Multiple E. coli strains (BL21(DE3), Rosetta, C41/C43 for membrane proteins)

  • Induction temperatures (16-37°C)

  • IPTG concentrations (0.1-1.0 mM)

  • Expression duration (3-24 hours)

For membrane proteins like HPAG1_0183, consider using specialized strains designed for membrane protein expression and inclusion of detergents during lysis and purification steps .

What purification strategies yield the highest purity of recombinant HPAG1_0183?

Purification of HPAG1_0183 requires a strategic approach, particularly given its likely membrane-associated nature:

  • Initial Capture:

    • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin for His-tagged protein

    • Gentle lysis using non-ionic detergents (e.g., n-dodecyl β-D-maltoside) to solubilize membrane proteins

    • Include protease inhibitors to prevent degradation

  • Intermediate Purification:

    • Ion exchange chromatography based on theoretical pI

    • Size exclusion chromatography to remove aggregates and isolate monomeric protein

  • Polishing:

    • Second IMAC step after tag cleavage (if tag removal is desired)

    • Buffer optimization for stability

Purification validation should include SDS-PAGE analysis targeting greater than 90% purity, as achieved in commercial preparations . Western blotting with anti-His antibodies confirms identity, while mass spectrometry provides definitive sequence verification.

How should recombinant HPAG1_0183 be stored to maintain optimal activity?

Proper storage of HPAG1_0183 is critical for maintaining functional integrity:

  • Short-term storage (1 week):

    • Store at 4°C in Tris/PBS-based buffer with 6% trehalose at pH 8.0

    • Avoid repeated freeze-thaw cycles

    • Maintain protein at concentrations between 0.1-1.0 mg/mL

  • Long-term storage:

    • Store at -20°C/-80°C with 50% glycerol as cryoprotectant

    • Aliquot in small volumes to avoid freeze-thaw cycles

    • Consider lyophilization for extended storage periods

  • Reconstitution protocol:

    • Centrifuge vials briefly before opening

    • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

    • Add glycerol to 5-50% final concentration for long-term storage

    • Validate protein integrity after reconstitution via SDS-PAGE or activity assays

Researchers should conduct stability studies at different temperatures and time points to determine optimal storage conditions for their specific research applications.

How can HPAG1_0183 be incorporated into studies of H. pylori pathogenesis?

Investigating HPAG1_0183's role in H. pylori pathogenesis requires thoughtful experimental design:

  • Gene knockout studies:

    • Generate HPAG1_0183 deletion mutants using homologous recombination

    • Compare colonization efficiency between wild-type and mutant strains in animal models

    • Assess mutant survival under various stress conditions (acid, oxidative, antibiotic)

  • Protein localization studies:

    • Create fluorescently tagged HPAG1_0183 constructs

    • Perform immunofluorescence microscopy to determine subcellular localization

    • Conduct fractionation studies to confirm membrane association

  • Host interaction studies:

    • Examine whether HPAG1_0183 interacts with host cell receptors via pull-down assays

    • Assess impact on host cell signaling pathways using phosphorylation arrays

    • Investigate influence on inflammatory responses in co-culture systems

Given H. pylori's high recombination and mutation rates , researchers should employ gastric organoid models which provide physiologically relevant environments for studying H. pylori interactions with host tissue .

What controls are essential when designing experiments with recombinant HPAG1_0183?

Robust experimental design with appropriate controls is fundamental for reliable results:

  • Negative controls:

    • Empty vector-transformed expression host for background protein effects

    • Non-relevant protein with similar tag/size for non-specific interactions

    • Buffer-only treatments to control for buffer components effects

  • Positive controls:

    • Well-characterized H. pylori membrane protein with known function

    • Commercial protein standards for quantification validation

    • Known interaction partners in binding studies

  • Validation controls:

    • Multiple detection methods (e.g., antibody validation with different epitopes)

    • Dose-response experiments to confirm specificity

    • Competition assays with unlabeled protein

Following experimental research best practices, randomization and blinding should be implemented when possible, particularly for in vivo studies . Statistical power analysis should determine appropriate sample sizes before experiment initiation.

How can structural studies of HPAG1_0183 inform functional research?

Structural characterization provides valuable insights into HPAG1_0183 function:

  • Crystallography approaches:

    • Optimize protein for crystallization by screening detergents for membrane proteins

    • Consider lipidic cubic phase crystallization for membrane proteins

    • Use nanobodies or antibody fragments to stabilize flexible regions

  • NMR spectroscopy:

    • Isotopic labeling (15N, 13C) during recombinant expression

    • Consider selective labeling of specific amino acids for targeted studies

    • Optimize detergent micelles for solution NMR studies

  • Cryo-electron microscopy:

    • Particularly valuable for membrane proteins in native-like environments

    • Consider reconstitution into nanodiscs or amphipols

    • Combine with computational modeling for complete structural understanding

Structural studies should be complemented with mutagenesis experiments targeting predicted functional domains to establish structure-function relationships. Computational approaches like molecular dynamics simulations can provide additional insights into protein flexibility and potential interaction surfaces.

How might HPAG1_0183 contribute to H. pylori's DNA damage response systems?

H. pylori exhibits remarkable genetic plasticity through high recombination and mutation rates, which contribute to its persistence in hosts . While HPAG1_0183's direct involvement in DNA repair has not been established, methodological approaches to investigate this include:

  • DNA damage sensitivity assays:

    • Compare survival of wild-type and HPAG1_0183 knockout strains after exposure to DNA-damaging agents (UV, H2O2, antibiotics)

    • Measure mutation rates using rifampicin resistance assays

    • Assess DNA repair kinetics following damage using comet assays

  • Protein-DNA interaction studies:

    • Electrophoretic mobility shift assays with purified HPAG1_0183

    • Chromatin immunoprecipitation to identify potential DNA binding sites

    • DNA protection assays to determine if HPAG1_0183 shields DNA from nucleases

  • Genetic interaction mapping:

    • Create double mutants with known DNA repair proteins (RuvABC, RecN)

    • Assess synthetic lethality or enhanced sensitivity phenotypes

    • Perform epistasis analysis to position HPAG1_0183 in repair pathways

H. pylori mutants defective in DNA repair proteins like RuvC and RecN show impaired colonization in mouse models , suggesting DNA repair processes are critical for in vivo persistence.

What approaches can elucidate HPAG1_0183's role in H. pylori stress responses?

H. pylori must survive extreme conditions in the gastric environment. To investigate HPAG1_0183's potential role in stress response:

  • Transcriptional profiling:

    • Compare HPAG1_0183 expression under various stressors (acid, oxidative, nutrient limitation)

    • Perform RNA-seq on wild-type versus HPAG1_0183 mutants under stress conditions

    • Identify co-regulated genes through cluster analysis

  • Protein network analysis:

    • Conduct pull-down experiments under different stress conditions

    • Perform quantitative proteomics to identify stress-dependent interactions

    • Map HPAG1_0183 within the broader stress response network

  • Phenotypic microarray analysis:

    • Compare metabolic profiles of wild-type and mutant strains under hundreds of conditions

    • Identify specific stressors where HPAG1_0183 provides advantage

    • Develop targeted follow-up assays for significant phenotypes

  • In vivo competition assays:

    • Co-infect animal models with tagged wild-type and HPAG1_0183 mutants

    • Measure relative abundance over time in different gastric regions

    • Correlate with local environmental conditions (pH, inflammation)

These approaches should be integrated with computational modeling to develop testable hypotheses about HPAG1_0183's specific role in stress response pathways.

How might HPAG1_0183 be utilized in vaccine development research against H. pylori?

Vaccine development against H. pylori remains an ongoing research challenge . To investigate HPAG1_0183's potential as a vaccine candidate:

  • Antigenicity assessment:

    • Analyze sequence conservation across H. pylori strains

    • Identify potential B and T cell epitopes using immunoinformatics

    • Validate immunogenicity in animal models using purified recombinant protein

  • Delivery system optimization:

    • Test different adjuvants and delivery platforms (liposomes, virus-like particles)

    • Compare mucosal versus systemic immunization routes

    • Evaluate prime-boost strategies for enhanced protection

  • Protection studies:

    • Challenge immunized animals with H. pylori

    • Quantify bacterial colonization and inflammatory responses

    • Assess correlates of protection through passive antibody transfer experiments

  • Combination approaches:

    • Evaluate HPAG1_0183 in combination with other H. pylori antigens

    • Test with inflammation-inhibiting approaches, as being explored by the Murdoch Children's Research Institute

    • Investigate potential synergistic effects with antibiotic therapy

Research should consider both prophylactic and therapeutic vaccination approaches, with careful attention to endpoints that correlate with reduced disease burden rather than just bacterial reduction.

What strategies address poor expression or solubility of recombinant HPAG1_0183?

Membrane proteins like HPAG1_0183 often present expression and solubility challenges. Methodological solutions include:

  • Expression optimization:

    • Test specialized E. coli strains (C41/C43, Lemo21) designed for membrane proteins

    • Reduce expression temperature (16-20°C) and IPTG concentration (0.1-0.5 mM)

    • Consider auto-induction media for gradual protein expression

    • Test different fusion tags (MBP, SUMO) known to enhance solubility

  • Solubilization approaches:

    • Screen detergent panel (DDM, LDAO, Fos-choline) for optimal extraction

    • Consider detergent-lipid mixtures to maintain native-like environment

    • Test amphipathic polymers (amphipols, SMALPs) for extraction without detergents

    • Optimize buffer conditions (pH, salt, additives) for stability

  • Refolding strategies (if inclusion bodies form):

    • Solubilize inclusion bodies with 8M urea or 6M guanidine hydrochloride

    • Perform step-wise dialysis with declining denaturant concentration

    • Add detergents during refolding to facilitate proper membrane protein folding

    • Include oxidized/reduced glutathione pairs to facilitate disulfide bond formation

  • Alternative expression systems:

    • Consider cell-free expression systems optimized for membrane proteins

    • Test yeast or insect cell expression for improved folding

Systematic documentation of optimization experiments in a design-of-experiments framework will efficiently identify optimal conditions.

How can researchers verify proper folding and functionality of purified HPAG1_0183?

Validating proper protein folding is essential before functional studies:

For membrane proteins like HPAG1_0183, reconstitution into liposomes or nanodiscs followed by functional assays provides the most physiologically relevant validation of proper folding.

What methods effectively optimize HPAG1_0183 for structural studies?

Preparing HPAG1_0183 for structural studies requires specialized approaches:

  • Construct optimization:

    • Create truncation constructs removing flexible regions

    • Use disorder prediction algorithms to guide construct design

    • Test multiple tags and linker lengths

    • Consider fusion to crystallization chaperones (T4 lysozyme, BRIL)

  • Homogeneity enhancement:

    • Use size exclusion chromatography to isolate monodisperse populations

    • Implement anion exchange chromatography as polishing step

    • Consider limited proteolysis to remove flexible regions

    • Remove aggregates through centrifugation or filtration

  • Crystallization screening:

    • Utilize specialized membrane protein screens

    • Test lipidic cubic phase and bicelle crystallization methods

    • Optimize detergent:protein ratios

    • Consider co-crystallization with antibody fragments or nanobodies

  • Sample preparation for cryo-EM:

    • Reconstitute in nanodiscs or amphipols for single-particle analysis

    • Optimize grid preparation (concentration, blotting time)

    • Use Spotiton or chameleon systems for reproducible grid preparation

    • Consider GraFix method to stabilize complexes

Monitoring sample quality throughout optimization using negative-stain EM and analytical ultracentrifugation provides critical feedback for iterative improvement.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.