Recombinant Helicobacter pylori UPF0114 protein HPG27_173 (HPG27_173)

How is recombinant HPG27_173 protein produced and purified?

Recombinant HPG27_173 protein is typically produced using an E. coli expression system. The full-length gene (encoding amino acids 1-177) is cloned into an expression vector with an N-terminal His-tag to facilitate purification . The production methodology follows these key steps:

• Transformation of the expression vector into a suitable E. coli strain

• Induction of protein expression (typically using IPTG for T7 promoter systems)

• Cell lysis to release expressed protein

• Affinity chromatography using the His-tag for initial purification

• Further purification steps as needed (size exclusion, ion exchange)

• Concentration and lyophilization of the purified protein

The resulting product is typically greater than 90% pure as determined by SDS-PAGE analysis . The recombinant protein includes the complete HPG27_173 sequence fused to an N-terminal His-tag, which facilitates detection and purification while maintaining functional properties of the native protein.

What are the optimal storage conditions for recombinant HPG27_173 protein?

For optimal stability and activity of recombinant HPG27_173 protein, the following storage conditions are recommended:

• Long-term storage: Store lyophilized powder at -20°C to -80°C

• After reconstitution: Add glycerol to a final concentration of 5-50% (50% recommended as default)

• Working aliquots: Store at 4°C for up to one week

• Avoid repeated freeze-thaw cycles as this can compromise protein integrity and activity

When preparing the protein for experiments, it is advisable to reconstitute the lyophilized powder in deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL . It is recommended to briefly centrifuge the vial prior to opening to ensure all content is at the bottom of the tube. For researchers conducting long-term studies, creating multiple small aliquots after reconstitution minimizes protein degradation from repeated freeze-thaw cycles.

What are the predicted structural features and domains of HPG27_173 protein?

Analysis of the HPG27_173 amino acid sequence reveals several key structural features:

The protein's sequence (MLEKLIERVLFATRWLLAPLCIAMSLVLVVLGYVFMKELWHMLSHLDTISETDLVLSALGLVDLLFMAGLVLMVLLASYESFVSKLDKVDASEITWLKHTDFNALKLKVSLSIVAISAIFLLKRYMSLEDVLSSIPKDTPLSHNPIFWQVVIHLVFVCSALLAAVTNNIAFSQNKGH) indicates it belongs to the UPF0114 family of proteins . While the exact function remains under investigation, the presence of multiple transmembrane regions suggests it may play a role in membrane integrity, transport processes, or signaling within Helicobacter pylori. The protein lacks obvious enzymatic domains but may function through protein-protein interactions or as a structural component of bacterial membranes.

How does the recombinant version of HPG27_173 compare to the native protein in functional assays?

When comparing recombinant HPG27_173 to its native counterpart in functional assays, researchers should consider several factors:

• The N-terminal His-tag may affect protein folding or function in certain assays, particularly if the N-terminus is important for activity or interaction with other molecules

• Expression in E. coli means the recombinant protein lacks post-translational modifications that might be present in native H. pylori

• The recombinant protein's reconstitution environment differs from the native bacterial membrane environment

For functional studies, researchers should:

• Include appropriate controls comparing His-tagged and tag-cleaved versions where possible

• Consider membrane reconstitution experiments to better mimic the native environment

• Validate findings with complementary approaches (e.g., gene knockout/complementation studies in H. pylori)

• Compare activity parameters between recombinant and native-source protein when feasible

While the recombinant protein maintains primary sequence identity with the native form, structural or functional differences may exist due to expression system differences and the presence of the His-tag . Methodological approaches that account for these potential differences are essential for accurate interpretation of functional data.

What is known about the role of HPG27_173 in Helicobacter pylori pathogenesis?

Current research on HPG27_173's role in H. pylori pathogenesis is still emerging. Based on structural analysis and comparative studies, several hypotheses exist regarding its potential functions:

• Membrane integrity: As a predicted membrane protein, it may contribute to bacterial cell envelope stability in the harsh gastric environment

• Adaptation to host environment: May play a role in acid resistance or survival mechanisms

• Transport functions: The transmembrane domains suggest possible involvement in nutrient acquisition or waste export

• Virulence regulation: Could function in signaling pathways that regulate expression of virulence factors

Research methodologies to investigate these hypotheses include:

• Gene knockout studies to assess changes in bacterial fitness and virulence

• Protein-protein interaction analyses to identify binding partners

• Transcriptomic profiling comparing wild-type and HPG27_173 mutant strains

• In vivo infection models to assess the impact on colonization and pathogenesis

While definitive roles remain to be fully characterized, the protein's conservation across H. pylori strains suggests functional importance. Researchers should design experiments that examine both in vitro phenotypes and in vivo relevance to comprehensively assess its contribution to pathogenesis.

What are the key considerations for reconstituting and handling HPG27_173 for experimental use?

For optimal experimental outcomes when working with recombinant HPG27_173 protein, researchers should implement the following methodological procedures:

• Reconstitution protocol:

  • Centrifuge the vial briefly before opening to collect all material at the bottom

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • For membrane protein studies, consider detergent addition (e.g., 0.1% DDM or CHAPS) to maintain solubility

  • Add glycerol to a final concentration of 5-50% for stability

• Quality assessment:

  • Verify protein integrity via SDS-PAGE before experimental use

  • If possible, conduct circular dichroism analysis to confirm secondary structure

  • For functional studies, establish activity baselines with positive controls

• Experimental handling:

  • Maintain protein at 4°C during experiment preparation

  • Prepare fresh working dilutions when possible

  • Include proper controls for the His-tag's potential interference in binding studies

The storage buffer (Tris/PBS-based buffer, 6% Trehalose, pH 8.0) is optimized for protein stability , but researchers should consider buffer exchange if their experimental system requires different conditions. When troubleshooting experimental issues, protein precipitation or loss of activity often indicates protein aggregation or denaturation, which may necessitate optimization of the reconstitution conditions.

How can researchers design experiments to investigate protein-protein interactions involving HPG27_173?

To effectively investigate protein-protein interactions involving HPG27_173, researchers should consider implementing these methodological approaches:

• Pull-down assays and co-immunoprecipitation:

  • Utilize the His-tag for initial pull-down experiments with H. pylori lysates

  • Employ reciprocal co-IP with antibodies against candidate interacting proteins

  • Include stringent controls for non-specific binding, especially given the hydrophobic nature of the protein

• Yeast two-hybrid or bacterial two-hybrid systems:

  • Consider using partial constructs excluding transmembrane domains for soluble hybrid proteins

  • Screen against H. pylori genomic libraries to identify novel interactors

  • Validate interactions with orthogonal methods

• Crosslinking approaches:

  • Chemical crosslinking followed by mass spectrometry can identify transient interactions

  • In vivo crosslinking in H. pylori provides physiologically relevant conditions

  • Various crosslinker lengths and chemistries can probe different interaction surfaces

• Membrane-based assays:

  • Reconstitute HPG27_173 in liposomes or nanodiscs for more native-like conditions

  • Assess interactions with other membrane components or peripheral proteins

  • Monitor changes in membrane properties as indicators of protein-protein interactions

Each experimental approach has specific advantages and limitations when studying membrane proteins like HPG27_173. A multi-faceted strategy combining several complementary techniques will provide the most robust evidence for genuine protein-protein interactions.

What techniques can be used to assess the localization and membrane topology of HPG27_173?

To determine the subcellular localization and membrane topology of HPG27_173, researchers should consider these methodological approaches:

• Immunofluorescence microscopy:

  • Generate specific antibodies against HPG27_173 or use anti-His antibodies with the recombinant protein

  • Perform studies in both fixed and live H. pylori cells

  • Compare localization patterns under different growth conditions or stresses

• Membrane fractionation:

  • Separate inner and outer membrane fractions of H. pylori

  • Use Western blotting to detect HPG27_173 in specific fractions

  • Include known markers for different membrane compartments as controls

• Protease accessibility assays:

  • Treat intact cells, spheroplasts, or membrane vesicles with proteases

  • Analyze proteolytic fragments to determine exposed regions

  • Compare results with computational topology predictions

• Reporter fusion studies:

  • Create fusions with reporters like GFP, PhoA, or β-lactamase at different positions

  • Assess reporter activity/fluorescence to infer topology

  • Validate with multiple complementary reporter systems

These techniques, when used in combination, provide complementary information about HPG27_173's localization and orientation within the bacterial membrane, enabling researchers to build accurate structural models of this protein in its native context.

What are common challenges in working with recombinant HPG27_173 and how can they be addressed?

Researchers working with recombinant HPG27_173 frequently encounter several technical challenges that can be addressed through specific methodological adjustments:

• Protein solubility issues:

  • Challenge: Precipitation after reconstitution due to hydrophobic nature

  • Solution: Incorporate mild detergents (0.1% DDM, CHAPS, or NP-40) during reconstitution

  • Alternative: Reconstitute directly into liposomes or nanodiscs for membrane proteins

• Activity loss during storage:

  • Challenge: Functional decline even with proper storage

  • Solution: Add stabilizing agents (5mM DTT for reducing environment, protease inhibitors)

  • Best practice: Prepare fresh working aliquots and avoid repeated freeze-thaw cycles

• Tag interference with function:

  • Challenge: His-tag affecting protein interactions or activity

  • Solution: Include tag-cleaved protein controls using TEV or thrombin protease

  • Validation: Compare results between tagged and untagged versions

• Antibody cross-reactivity:

  • Challenge: Non-specific binding in immunological detection methods

  • Solution: Pre-absorb antibodies with E. coli lysates to remove cross-reactivity

  • Control: Include samples from HPG27_173 knockout strains as negative controls

When troubleshooting these issues, a systematic approach comparing multiple conditions simultaneously can efficiently identify optimal working parameters. For membrane proteins like HPG27_173, maintaining an environment that mimics the native membrane is particularly important for preserving structural integrity and function.

How can researchers validate the structural integrity of recombinant HPG27_173 prior to functional studies?

To ensure that recombinant HPG27_173 maintains its structural integrity before proceeding with functional characterization, researchers should implement these quality control methods:

• Spectroscopic techniques:

  • Circular dichroism (CD) spectroscopy to assess secondary structure composition

  • Fluorescence spectroscopy to monitor tertiary structure through intrinsic tryptophan fluorescence

  • FTIR analysis to examine protein secondary structure in membrane environments

• Hydrodynamic characterization:

  • Size exclusion chromatography to verify monodispersity and detect aggregation

  • Dynamic light scattering to assess size distribution and potential oligomerization

  • Analytical ultracentrifugation for precise determination of oligomeric state

• Thermal stability assessment:

  • Differential scanning calorimetry to determine thermal transition points

  • Thermal shift assays (e.g., Thermofluor) for high-throughput stability screening

  • Activity measurements at different temperatures to establish functional stability range

• Structural probes:

  • Limited proteolysis to assess folded conformation (properly folded proteins show resistance to digestion)

  • Chemical crosslinking to examine quaternary structure

  • Hydrogen-deuterium exchange mass spectrometry to probe solvent accessibility

These validation steps should be performed before investing significant time in functional studies, as they provide critical information about whether the recombinant protein maintains native-like structure. For transmembrane proteins like HPG27_173, structural integrity is particularly sensitive to buffer conditions, detergent choice, and reconstitution methods.

How can HPG27_173 be used to study Helicobacter pylori membrane biology?

Recombinant HPG27_173 serves as a valuable tool for investigating H. pylori membrane biology through several research applications:

• Membrane organization studies:

  • Incorporation of labeled HPG27_173 into model membranes to study lipid interactions

  • Analysis of protein clustering and microdomain formation using fluorescence microscopy

  • Investigation of membrane fluidity changes in the presence of HPG27_173

• Structural biology approaches:

  • Crystallization trials for structural determination of this UPF0114 family protein

  • Cryo-EM studies of HPG27_173 in membrane environments

  • NMR studies of labeled protein to examine dynamic regions and ligand interactions

• Comparative genomics applications:

  • Structure-function comparisons with homologs from other Helicobacter species

  • Evolutionary analysis of sequence conservation to identify functional motifs

  • Identification of strain-specific variations that might correlate with virulence

• Interaction network mapping:

  • Use as bait protein in systematic interactome studies

  • Identification of membrane protein complexes containing HPG27_173

  • Elucidation of temporal changes in interaction partners during infection

These applications collectively provide insights into the organization and function of H. pylori membranes, which are crucial for bacterial survival in the harsh gastric environment. The recombinant protein allows for controlled experimental conditions that would be difficult to achieve when studying the native protein in bacterial cells.

What are the implications of HPG27_173 research for developing new therapeutic approaches against Helicobacter pylori?

Research on HPG27_173 has several potential implications for therapeutic development against H. pylori infections:

• Target validation approaches:

  • Essentiality studies to determine if HPG27_173 is required for bacterial survival

  • In vivo infection models comparing wild-type and HPG27_173 mutant strains

  • Identification of conditions where HPG27_173 becomes critically important for bacterial fitness

• Drug discovery applications:

  • High-throughput screening assays using recombinant HPG27_173 to identify binding molecules

  • Fragment-based drug discovery targeting specific regions of the protein

  • Computer-aided drug design based on structural models of HPG27_173

• Antibody-based therapeutics:

  • Development of antibodies targeting surface-exposed epitopes of HPG27_173

  • Evaluation of antibody-dependent mechanisms for bacterial clearance

  • Design of bispecific antibodies linking HPG27_173 recognition with immune activation

• Vaccine development considerations:

  • Assessment of HPG27_173 as a potential vaccine antigen

  • Analysis of sequence conservation across clinical isolates

  • Epitope mapping to identify immunogenic regions for subunit vaccine design