Recombinant Helicobacter pylori UPF0114 protein HPP12_0190 (HPP12_0190)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
HPP12_0190; UPF0114 protein HPP12_0190
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-177
Protein Length
full length protein
Species
Helicobacter pylori (strain P12)
Target Names
HPP12_0190
Target Protein Sequence
MLEKLIERVLFATRWLLAPLCIAMSLVLVVLGYAFMKELWHMLSHLDTISETDLVLSALG LVDLLFMAGLVLMVLLASYESFVSKLDKVDASEITWLKHTDFNALKLKVSLSIVAISAIF LLKRYMSLEDVLSSIPKDTPLSHNPIFWQVVINLVFVCSALLAAVTNNIAFSQNKAH
Uniprot No.

Target Background

Database Links
Protein Families
UPF0114 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Helicobacter pylori UPF0114 protein HPP12_0190?

Recombinant Helicobacter pylori UPF0114 protein HPP12_0190 is a full-length protein (1-177 amino acids) derived from Helicobacter pylori and expressed in E. coli expression systems. The protein has the UniProt ID B6JPT9 and is typically produced with an N-terminal His-tag for purification purposes . This recombinant protein represents the complete native sequence of the UPF0114 protein found in H. pylori strain P12, making it valuable for structural and functional studies of this bacterial protein . The protein's amino acid sequence is as follows: MLEKLIERVLFATRWLLAPLCIAMSLVLVVLGYAFMKELWHMLSHLDTISETDLVLSALGLVDLLFMAGLVLMVLLASYESFVSKLDKVDASEITWLKHTDFNALKLKVSLSIVAISAIFLLKRYMSLEDVLSSIPKDTPLSHNPIFWQVVINLVFVCSALLAAVTNNIAFSQNKAH . This recombinant form allows researchers to study the protein's properties outside its native bacterial environment.

What are the optimal storage conditions for this recombinant protein?

For optimal preservation of protein integrity and activity, Recombinant Helicobacter pylori UPF0114 protein HPP12_0190 should be stored according to specific protocols. Upon receipt, the protein (typically supplied as a lyophilized powder) should be briefly centrifuged before opening to ensure all material is at the bottom of the vial . For long-term storage, aliquoting the reconstituted protein with 50% glycerol (final concentration) and storing at -20°C/-80°C is recommended to prevent protein degradation . For working stocks, aliquots can be stored at 4°C for up to one week, but repeated freeze-thaw cycles should be strictly avoided as they can compromise protein structure and function . The protein is typically supplied in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0, which helps maintain stability during storage . These storage conditions are critical for maintaining the protein's structural integrity and biological activity for experimental applications.

How should the lyophilized protein be reconstituted for experimental use?

Proper reconstitution of the lyophilized Recombinant Helicobacter pylori UPF0114 protein HPP12_0190 is essential for experimental success. The recommended protocol is to reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL . Before reconstitution, it is advisable to briefly centrifuge the vial to bring all contents to the bottom, ensuring no material is lost during the opening process . After adding the appropriate volume of water, the solution should be gently mixed until completely dissolved, avoiding vigorous shaking or vortexing that could denature the protein. For long-term storage of the reconstituted protein, adding glycerol to a final concentration of 5-50% is recommended, with 50% being the manufacturer's default recommendation . This glycerol addition provides cryoprotection and prevents damage during freezing. After reconstitution, the protein should be aliquoted into smaller volumes to minimize freeze-thaw cycles and stored according to the storage recommendations discussed previously.

How can researchers verify the purity and integrity of the protein before experiments?

Verifying the purity and integrity of Recombinant Helicobacter pylori UPF0114 protein HPP12_0190 before experimentation is critical for reliable results. While manufacturers typically provide purity information (>90% by SDS-PAGE) , independent verification is recommended. SDS-PAGE analysis should be performed to confirm both purity and molecular weight (approximately 20 kDa plus the tag size), with Coomassie blue or silver staining depending on protein concentration . Western blotting using anti-His tag antibodies can confirm the presence of the intact His-tagged protein. For higher resolution analysis, consider mass spectrometry to verify the exact molecular weight and potential post-translational modifications. Circular dichroism spectroscopy can assess proper protein folding and secondary structure. Additionally, size-exclusion chromatography can detect aggregation or degradation products that might affect experimental outcomes. Functional assays specific to the protein's known or predicted activity should be established as quality control measures. These verification steps should be performed immediately after reconstitution and documented with appropriate controls to establish a quality baseline before proceeding with experimental protocols. This multi-method approach ensures that the protein being used meets the purity and structural integrity requirements for valid experimental results.

What are the key variables to consider when designing experiments with this recombinant protein?

When designing experiments with Recombinant Helicobacter pylori UPF0114 protein HPP12_0190, researchers must consider several critical variables to ensure reliable and reproducible results. First, protein concentration must be carefully controlled and optimized for each specific assay type, as both insufficient and excessive protein levels can lead to misleading results . Buffer composition and pH are also crucial variables, as they can significantly affect protein stability and activity; researchers should test the protein in various buffers beyond the storage buffer if needed for specific applications . Temperature conditions during experiments require careful consideration—while some assays may run at room temperature, others may require physiological temperatures (37°C) to mimic bacterial environments. The presence of potential cofactors or binding partners should be evaluated, as they may be necessary for protein function. Incubation time is another key variable that may need optimization based on reaction kinetics . When testing across different experimental conditions, implementing a systematic approach using either between-subjects or within-subjects design is recommended to isolate the effects of specific variables . For each experiment, researchers should clearly define both independent variables (those being manipulated) and dependent variables (outcomes being measured) to establish causal relationships . Controlling for these variables through careful experimental design will help minimize variability and increase the reliability of research findings.

How can this protein be used in structural biology studies?

Recombinant Helicobacter pylori UPF0114 protein HPP12_0190 presents valuable opportunities for structural biology investigations. For X-ray crystallography studies, the highly purified protein (>90%) can be subjected to crystallization trials using vapor diffusion methods with various precipitants. Researchers should optimize protein concentration (typically 5-15 mg/ml) and screen different buffer conditions to identify those promoting crystal formation. For nuclear magnetic resonance (NMR) spectroscopy, isotopically labeled protein can be produced by expressing it in E. coli grown in media containing 15N-ammonium chloride and/or 13C-glucose. The His-tag may affect structural studies, so researchers should consider whether to remove it using specific proteases, weighing the benefits against potential protein yield loss. Cryo-electron microscopy (cryo-EM) offers another approach for structural determination, particularly if the protein forms larger complexes. Small-angle X-ray scattering (SAXS) can provide information about the protein's shape in solution. For all these methods, sample homogeneity is crucial, so researchers should perform size-exclusion chromatography immediately before structural experiments. The amino acid sequence analysis suggests transmembrane regions, which may require special considerations including the use of appropriate detergents or nanodiscs to mimic the membrane environment . Comparative structural analysis with other UPF0114 family proteins should be conducted to identify conserved structural features that might indicate functional significance.

What approaches can be used to investigate protein-protein interactions involving HPP12_0190?

To investigate protein-protein interactions involving Recombinant Helicobacter pylori UPF0114 protein HPP12_0190, researchers should employ multiple complementary approaches. Pull-down assays utilizing the protein's His-tag can be performed by immobilizing the recombinant protein on Ni-NTA beads and incubating with H. pylori lysates or candidate interacting proteins, followed by washing and elution steps . Surface plasmon resonance (SPR) offers quantitative kinetic analysis of protein interactions, where HPP12_0190 can be immobilized on a sensor chip, and potential binding partners flowed over the surface to measure association and dissociation rates. Isothermal titration calorimetry (ITC) provides thermodynamic parameters of interactions without requiring protein modifications. For cellular studies, yeast two-hybrid or bacterial two-hybrid systems can screen for potential interactors from genomic libraries. Proximity-based labeling methods such as BioID or APEX can identify proteins in close proximity to HPP12_0190 in a cellular context. Microscale thermophoresis (MST) offers another solution-based method to detect interactions and determine binding affinities. When designing these experiments, consider the protein's predicted membrane association and include appropriate controls for each method. Cross-validation of interactions using multiple techniques is essential, as each method has specific strengths and limitations. A systematic experimental design approach should be implemented, clearly defining variables and establishing appropriate controls for each interaction assay . The combined data from these approaches will provide robust evidence for protein-protein interactions involving HPP12_0190.

How can functional studies be designed to elucidate the role of HPP12_0190 in Helicobacter pylori pathogenesis?

Designing functional studies to elucidate the role of HPP12_0190 in Helicobacter pylori pathogenesis requires a comprehensive experimental approach. Gene knockout or knockdown studies in H. pylori should be conducted to generate strains lacking or with reduced expression of the HPP12_0190 gene, followed by phenotypic characterization including growth curves, morphology assessment, and acid resistance tests . Complementation studies, reintroducing the wild-type or mutant versions of the gene, can confirm phenotype specificity. Cell culture infection models using gastric epithelial cell lines should compare wild-type and mutant H. pylori strains for differences in adhesion, invasion, and host cell responses (cytokine production, signal pathway activation). Animal infection models, preferably in mice or gerbils, can evaluate the impact of HPP12_0190 on colonization efficiency and pathology development. Site-directed mutagenesis of specific protein regions, based on structural predictions or conserved domains, can identify functionally important residues . Transcriptomic and proteomic analyses comparing wild-type and knockout strains can reveal affected pathways. For all these approaches, implement proper experimental design principles: define clear variables, formulate specific hypotheses, design appropriate treatments, assign subjects to experimental groups, and plan precise measurement methods . Each experiment should include positive and negative controls, and researchers should be aware of possible confounding variables. This multifaceted approach will provide comprehensive insights into the protein's role in H. pylori pathogenesis while adhering to rigorous experimental design standards.

What are the potential pitfalls when working with this recombinant protein and how can they be addressed?

When working with Recombinant Helicobacter pylori UPF0114 protein HPP12_0190, researchers may encounter several challenges that can compromise experimental outcomes. Protein aggregation is a common issue, particularly after reconstitution or during storage. This can be addressed by including low concentrations (0.1-0.5%) of non-ionic detergents like Triton X-100 in the buffer if compatible with downstream applications . Protein degradation may occur during extended storage or experimental procedures, which can be monitored by periodic SDS-PAGE analysis of stored aliquots and minimized by adding protease inhibitors to working solutions. The presence of the His-tag might interfere with protein function or interaction studies; researchers should consider both tagged and tag-cleaved versions of the protein for comparative analysis . Low protein solubility might be encountered due to the protein's predicted membrane association ; optimization of buffer conditions or the addition of solubilizing agents may be necessary. Inconsistent activity between protein batches can significantly impact experimental reproducibility, necessitating careful quality control testing of each new batch against established standards. Non-specific binding in interaction studies can lead to false positives; include stringent washing steps and appropriate blocking agents in binding assays. For each potential pitfall, researchers should implement specific experimental controls to distinguish genuine results from artifacts . Maintaining detailed records of protein handling and experimental conditions will facilitate troubleshooting if unexpected results occur. By anticipating these challenges and implementing preventive measures, researchers can enhance the reliability of their experimental outcomes.

How can researchers optimize protein expression and purification protocols for HPP12_0190?

Optimizing expression and purification of Recombinant Helicobacter pylori UPF0114 protein HPP12_0190 requires systematic evaluation of multiple parameters. For expression optimization, test different E. coli strains (BL21(DE3), Rosetta, Arctic Express) as host cells to identify the optimal system for this specific protein . Experiment with various induction conditions by varying IPTG concentrations (0.1-1.0 mM), induction temperatures (16-37°C), and induction durations (3-24 hours). Lower temperatures (16-20°C) often improve the solubility of recombinant proteins. For purification optimization, evaluate different lysis methods (sonication, high-pressure homogenization, or chemical lysis) to maximize protein extraction while minimizing degradation. Test various binding conditions for His-tag affinity purification, including buffer composition, imidazole concentrations in washing steps (10-50 mM), and elution gradients versus step elution . Consider secondary purification steps such as ion-exchange or size-exclusion chromatography to achieve higher purity. For this membrane-associated protein, inclusion of appropriate detergents (0.1% n-Dodecyl β-D-maltoside or similar) in purification buffers may improve yield and prevent aggregation . Implementation of a systematic experimental design approach is crucial—test one variable at a time while keeping others constant, or use factorial design to assess interactions between variables . For each condition, analyze protein yield, purity, and functional activity. Document all parameters in a detailed protocol to ensure reproducibility. This methodical optimization approach will lead to higher quality protein preparations for downstream applications.

What analytical techniques are most appropriate for characterizing the structural features of HPP12_0190?

Characterizing the structural features of Recombinant Helicobacter pylori UPF0114 protein HPP12_0190 requires a multi-technique approach to capture different aspects of protein structure. Circular dichroism (CD) spectroscopy should be employed to analyze secondary structure elements (α-helices, β-sheets, random coils) and provide initial insights into protein folding. The amino acid sequence suggests potential transmembrane regions, making techniques that can analyze membrane proteins particularly valuable . Fourier-transform infrared spectroscopy (FTIR) can complement CD by providing additional secondary structure information, especially for proteins with membrane-associated regions. Nuclear magnetic resonance (NMR) spectroscopy can provide atomic-level structural information if isotopically labeled protein is available, though size limitations should be considered. For tertiary structure determination, X-ray crystallography remains the gold standard if suitable crystals can be obtained. Small-angle X-ray scattering (SAXS) offers lower resolution but can provide valuable information about the protein's shape in solution without requiring crystallization. Hydrogen-deuterium exchange mass spectrometry (HDX-MS) can identify solvent-exposed regions and potential binding interfaces. Molecular dynamics simulations, based on homology models if no experimental structure is available, can provide insights into protein flexibility and potential functional regions. When implementing these techniques, researchers should follow established experimental design principles, defining clear objectives for structural characterization and controlling for variables that might affect structural measurements . Integration of data from multiple techniques provides the most comprehensive structural characterization and increases confidence in the structural features identified.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.