Recombinant Helicobacter pylori UPF0114 protein HPSH_00970 (HPSH_00970)

Shipped with Ice Packs
In Stock

Description

Production and Characteristics

The HPSH_00970 protein is produced via recombinant expression in E. coli and purified to >90% purity by SDS-PAGE . Key specifications include:

ParameterDetails
SourceHelicobacter pylori (strain Shi470)
TagN-terminal His tag
LengthFull-length (1–178 amino acids)
Storage BufferTris/PBS-based buffer with 6% trehalose (pH 8.0) or 50% glycerol
Storage-20°C/-80°C; avoid repeated freeze-thaw cycles

The amino acid sequence (AA) is:
MLEKLIERVLFATRWLLAPLCIAMSLVLVVLGYVFMKELWHMLSHLDTISETDLVLSALGLVDLLFMAGLVLMVLLASYESFVSKLDKVDASEITWLKHTDFNALKLKVSLSIVAISAIFLLKRYMSLEDVLSSIPKDTPLSHNPIFWQVVIHLVFVCSALLAAVTNNIAFSQNNKGH .

Research Applications

This recombinant protein is used in:

  1. Vaccine Development: As an antigen for immune response studies .

  2. ELISA Assays: For detecting anti-H. pylori antibodies .

  3. Protein Interaction Studies: To identify binding partners in pathogenesis .

Comparative Analysis with Related Proteins

The HPSH_00970 protein shares sequence homology with other H. pylori UPF0114 proteins, such as HPG27_173 (UniProt ID: B5Z9W0) . Key differences include:

ProteinStrainUniProt IDKey Distinguishing Feature
HPSH_00970Shi470B2US19N-terminal His tag for purification
HPG27_173G27B5Z9W0Lacks glycerol in storage buffer

Research Gaps and Future Directions

While the protein’s role in H. pylori pathogenesis remains unclear, areas for further study include:

  • Functional characterization: Investigating enzymatic activity or host cell interactions.

  • Structural biology: Solving its 3D structure to identify binding sites.

  • Therapeutic targeting: Assessing its potential as a vaccine candidate or drug target .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
HPSH_00970; UPF0114 protein HPSH_00970
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-178
Protein Length
full length protein
Species
Helicobacter pylori (strain Shi470)
Target Names
HPSH_00970
Target Protein Sequence
MLEKLIERVLFATRWLLAPLCIAMSLVLVVLGYVFMKELWHMLSHLDTISETDLVLSALG LVDLLFMAGLVLMVLLASYESFVSKLDKVDASEITWLKHTDFNALKLKVSLSIVAISAIF LLKRYMSLEDVLSSIPKDTPLSHNPIFWQVVIHLVFVCSALLAAVTNNIAFSQNNKGH
Uniprot No.

Target Background

Database Links
Protein Families
UPF0114 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Helicobacter pylori UPF0114 protein HPSH_00970?

Recombinant Helicobacter pylori UPF0114 protein HPSH_00970 (UniProt ID: B2US19) is a full-length protein consisting of 178 amino acids expressed in E. coli with an N-terminal His tag. The protein belongs to the UPF0114 protein family, which remains functionally uncharacterized but is conserved across different Helicobacter pylori strains. The recombinant form is typically supplied as a lyophilized powder with greater than 90% purity as determined by SDS-PAGE .

What are the optimal storage conditions for HPSH_00970?

For long-term storage, HPSH_00970 should be stored at -20°C/-80°C with appropriate aliquoting to avoid repeated freeze-thaw cycles, which can compromise protein integrity. Working aliquots can be maintained at 4°C for up to one week. The protein is typically stored in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0. For reconstitution, it is recommended to use deionized sterile water to a concentration of 0.1-1.0 mg/mL, followed by addition of 5-50% glycerol (final concentration) for long-term storage .

How does HPSH_00970 differ from HPP12_0190, another UPF0114 protein from H. pylori?

While both HPSH_00970 and HPP12_0190 belong to the UPF0114 protein family from H. pylori, they exhibit subtle differences in their amino acid sequences that may reflect strain-specific adaptations. HPSH_00970 consists of 178 amino acids (UniProt ID: B2US19), whereas HPP12_0190 has 177 amino acids (UniProt ID: B6JPT9). Sequence alignment reveals high similarity with key differences at positions:

PositionHPSH_00970HPP12_0190
25YA
153HN
177-178GHAH

These differences may influence protein folding, membrane integration, or interaction capabilities, warranting comparative functional studies between the two proteins .

What approaches can be used to elucidate the function of HPSH_00970?

As a protein of unknown function (UPF), determining the role of HPSH_00970 requires a multi-faceted approach:

  • Structural analysis: Utilize techniques such as X-ray crystallography, NMR spectroscopy, or AI-based structure prediction tools like AlphaFold2 to determine the three-dimensional structure, which may provide insights into function .

  • Protein-protein interaction studies: Employ co-immunoprecipitation, yeast two-hybrid screening, or proximity labeling methods to identify interaction partners within H. pylori.

  • Gene knockout/knockdown: Create HPSH_00970 deletion mutants in H. pylori to observe phenotypic changes in bacterial growth, virulence, or stress response.

  • Comparative genomics: Analyze conservation patterns across bacterial species to infer functional importance based on evolutionary conservation .

  • Localization studies: Use fluorescent protein tagging or immunolocalization to determine the subcellular localization, which can provide functional clues.

How can I validate antibody specificity against HPSH_00970?

Antibody validation for HPSH_00970 should follow a systematic approach:

  • Western blot analysis: Test antibody against purified recombinant HPSH_00970 alongside negative controls (E. coli lysate without the recombinant protein) and positive controls (H. pylori lysate).

  • Cross-reactivity assessment: Evaluate potential cross-reactivity with the closely related HPP12_0190 protein by testing against both recombinant proteins simultaneously.

  • Epitope mapping: Determine the specific epitope(s) recognized by the antibody using peptide arrays or deletion mutants.

  • Immunoprecipitation efficiency: Quantify the percentage of target protein successfully immunoprecipitated from complex mixtures.

  • Validation in knockout models: Test antibody specificity in HPSH_00970 knockout H. pylori strains to confirm absence of signal.

What is the optimal protocol for recombinant HPSH_00970 reconstitution?

The optimal reconstitution protocol for HPSH_00970 involves several critical steps:

  • Briefly centrifuge the vial prior to opening to ensure all lyophilized material is at the bottom.

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL at room temperature, gently mixing until completely dissolved.

  • For long-term storage, add glycerol to a final concentration of 5-50% (optimally 50%).

  • Aliquot the reconstituted protein into sterile microcentrifuge tubes to minimize freeze-thaw cycles.

  • Flash freeze aliquots in liquid nitrogen before transferring to -20°C/-80°C storage .

This methodology ensures maximum retention of protein activity and structural integrity throughout multiple experimental uses.

What are effective methods for studying membrane association of HPSH_00970?

HPSH_00970's amino acid sequence suggests it may be a membrane-associated protein. Effective methods for investigating this characteristic include:

  • Membrane fractionation: Separate bacterial membrane fractions (inner and outer membranes) using sucrose gradient ultracentrifugation followed by western blot analysis to determine HPSH_00970 localization.

  • Hydrophobicity analysis: Computational prediction of transmembrane domains using programs like TMHMM, Phobius, or HMMTOP to identify potential membrane-spanning regions.

  • Protease protection assays: Treat intact bacterial cells with proteases that cannot penetrate the membrane, then analyze which protein regions are protected versus cleaved.

  • Fluorescent protein fusion: Create GFP-HPSH_00970 fusion proteins for live-cell imaging to visualize membrane localization patterns.

  • Lipid binding assays: Assess direct interaction with specific membrane lipids using protein-lipid overlay assays or liposome flotation assays.

How can HPSH_00970 be utilized in H. pylori pathogenesis studies?

HPSH_00970's potential roles in H. pylori pathogenesis can be investigated through several research applications:

  • Host-pathogen interaction studies: Determine if HPSH_00970 interacts with host cell receptors or immune system components using pull-down assays or surface plasmon resonance.

  • Colonization models: Compare colonization efficiency between wild-type and HPSH_00970-deficient H. pylori strains in cell culture or animal models.

  • Immune response analysis: Evaluate host immune responses to purified HPSH_00970 protein using cytokine profiling and immune cell activation assays.

  • Drug target validation: Assess HPSH_00970 as a potential therapeutic target by screening small molecule inhibitors or antibodies that disrupt its function .

  • Biofilm formation: Investigate the role of HPSH_00970 in H. pylori biofilm development, which contributes to antibiotic resistance and persistent infection.

What approaches can be used to investigate post-translational modifications of HPSH_00970?

Post-translational modifications (PTMs) can significantly impact protein function. To investigate PTMs in HPSH_00970:

  • Mass spectrometry analysis: Perform LC-MS/MS on purified native HPSH_00970 from H. pylori to identify PTMs such as phosphorylation, glycosylation, or acetylation.

  • Site-directed mutagenesis: Create mutant versions where predicted modification sites are altered to amino acids that cannot be modified.

  • Modification-specific antibodies: Utilize antibodies that specifically recognize common PTMs to detect modified forms of HPSH_00970.

  • 2D gel electrophoresis: Separate protein isoforms based on charge and mass differences resulting from PTMs.

  • In vitro modification assays: Test whether HPSH_00970 can serve as a substrate for known H. pylori modification enzymes.

What are common issues in working with recombinant HPSH_00970 and how can they be addressed?

Several challenges may arise when working with recombinant HPSH_00970:

  • Protein aggregation: If aggregation occurs after reconstitution, try reducing protein concentration, adding mild detergents (0.05% Tween-20), or optimizing buffer conditions (pH, salt concentration).

  • Loss of activity during storage: Minimize freeze-thaw cycles by creating single-use aliquots and ensure proper glycerol concentration (recommended 50%) for freezing .

  • Non-specific binding in assays: Include appropriate blocking agents (BSA, non-fat milk) and consider pre-clearing samples when performing immunoprecipitation or pull-down assays.

  • Precipitation during buffer exchange: Perform buffer exchanges gradually with stepwise dialysis or use spin concentrators with lower centrifugation speeds.

  • Batch-to-batch variation: Always include internal controls and standardize protein quantification methods across experiments.

How can I assess the structural integrity of purified HPSH_00970?

To evaluate whether purified HPSH_00970 maintains its native structural properties:

  • Circular dichroism (CD) spectroscopy: Measure secondary structure content to confirm proper folding.

  • Size exclusion chromatography: Analyze elution profile to detect aggregation or oligomerization states.

  • Dynamic light scattering (DLS): Determine size distribution to identify potential aggregation.

  • Thermal shift assays: Assess protein stability under different buffer conditions using fluorescent dyes that bind to hydrophobic regions exposed during unfolding.

  • Activity assays: If function becomes known, develop functional assays to confirm biological activity as the ultimate measure of structural integrity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.