The HPSH_00970 protein is produced via recombinant expression in E. coli and purified to >90% purity by SDS-PAGE . Key specifications include:
The amino acid sequence (AA) is:
MLEKLIERVLFATRWLLAPLCIAMSLVLVVLGYVFMKELWHMLSHLDTISETDLVLSALGLVDLLFMAGLVLMVLLASYESFVSKLDKVDASEITWLKHTDFNALKLKVSLSIVAISAIFLLKRYMSLEDVLSSIPKDTPLSHNPIFWQVVIHLVFVCSALLAAVTNNIAFSQNNKGH .
This recombinant protein is used in:
Vaccine Development: As an antigen for immune response studies .
Protein Interaction Studies: To identify binding partners in pathogenesis .
The HPSH_00970 protein shares sequence homology with other H. pylori UPF0114 proteins, such as HPG27_173 (UniProt ID: B5Z9W0) . Key differences include:
| Protein | Strain | UniProt ID | Key Distinguishing Feature |
|---|---|---|---|
| HPSH_00970 | Shi470 | B2US19 | N-terminal His tag for purification |
| HPG27_173 | G27 | B5Z9W0 | Lacks glycerol in storage buffer |
While the protein’s role in H. pylori pathogenesis remains unclear, areas for further study include:
KEGG: hps:HPSH_00970
Recombinant Helicobacter pylori UPF0114 protein HPSH_00970 (UniProt ID: B2US19) is a full-length protein consisting of 178 amino acids expressed in E. coli with an N-terminal His tag. The protein belongs to the UPF0114 protein family, which remains functionally uncharacterized but is conserved across different Helicobacter pylori strains. The recombinant form is typically supplied as a lyophilized powder with greater than 90% purity as determined by SDS-PAGE .
For long-term storage, HPSH_00970 should be stored at -20°C/-80°C with appropriate aliquoting to avoid repeated freeze-thaw cycles, which can compromise protein integrity. Working aliquots can be maintained at 4°C for up to one week. The protein is typically stored in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0. For reconstitution, it is recommended to use deionized sterile water to a concentration of 0.1-1.0 mg/mL, followed by addition of 5-50% glycerol (final concentration) for long-term storage .
While both HPSH_00970 and HPP12_0190 belong to the UPF0114 protein family from H. pylori, they exhibit subtle differences in their amino acid sequences that may reflect strain-specific adaptations. HPSH_00970 consists of 178 amino acids (UniProt ID: B2US19), whereas HPP12_0190 has 177 amino acids (UniProt ID: B6JPT9). Sequence alignment reveals high similarity with key differences at positions:
| Position | HPSH_00970 | HPP12_0190 |
|---|---|---|
| 25 | Y | A |
| 153 | H | N |
| 177-178 | GH | AH |
These differences may influence protein folding, membrane integration, or interaction capabilities, warranting comparative functional studies between the two proteins .
As a protein of unknown function (UPF), determining the role of HPSH_00970 requires a multi-faceted approach:
Structural analysis: Utilize techniques such as X-ray crystallography, NMR spectroscopy, or AI-based structure prediction tools like AlphaFold2 to determine the three-dimensional structure, which may provide insights into function .
Protein-protein interaction studies: Employ co-immunoprecipitation, yeast two-hybrid screening, or proximity labeling methods to identify interaction partners within H. pylori.
Gene knockout/knockdown: Create HPSH_00970 deletion mutants in H. pylori to observe phenotypic changes in bacterial growth, virulence, or stress response.
Comparative genomics: Analyze conservation patterns across bacterial species to infer functional importance based on evolutionary conservation .
Localization studies: Use fluorescent protein tagging or immunolocalization to determine the subcellular localization, which can provide functional clues.
Antibody validation for HPSH_00970 should follow a systematic approach:
Western blot analysis: Test antibody against purified recombinant HPSH_00970 alongside negative controls (E. coli lysate without the recombinant protein) and positive controls (H. pylori lysate).
Cross-reactivity assessment: Evaluate potential cross-reactivity with the closely related HPP12_0190 protein by testing against both recombinant proteins simultaneously.
Epitope mapping: Determine the specific epitope(s) recognized by the antibody using peptide arrays or deletion mutants.
Immunoprecipitation efficiency: Quantify the percentage of target protein successfully immunoprecipitated from complex mixtures.
Validation in knockout models: Test antibody specificity in HPSH_00970 knockout H. pylori strains to confirm absence of signal.
The optimal reconstitution protocol for HPSH_00970 involves several critical steps:
Briefly centrifuge the vial prior to opening to ensure all lyophilized material is at the bottom.
Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL at room temperature, gently mixing until completely dissolved.
For long-term storage, add glycerol to a final concentration of 5-50% (optimally 50%).
Aliquot the reconstituted protein into sterile microcentrifuge tubes to minimize freeze-thaw cycles.
Flash freeze aliquots in liquid nitrogen before transferring to -20°C/-80°C storage .
This methodology ensures maximum retention of protein activity and structural integrity throughout multiple experimental uses.
HPSH_00970's amino acid sequence suggests it may be a membrane-associated protein. Effective methods for investigating this characteristic include:
Membrane fractionation: Separate bacterial membrane fractions (inner and outer membranes) using sucrose gradient ultracentrifugation followed by western blot analysis to determine HPSH_00970 localization.
Hydrophobicity analysis: Computational prediction of transmembrane domains using programs like TMHMM, Phobius, or HMMTOP to identify potential membrane-spanning regions.
Protease protection assays: Treat intact bacterial cells with proteases that cannot penetrate the membrane, then analyze which protein regions are protected versus cleaved.
Fluorescent protein fusion: Create GFP-HPSH_00970 fusion proteins for live-cell imaging to visualize membrane localization patterns.
Lipid binding assays: Assess direct interaction with specific membrane lipids using protein-lipid overlay assays or liposome flotation assays.
HPSH_00970's potential roles in H. pylori pathogenesis can be investigated through several research applications:
Host-pathogen interaction studies: Determine if HPSH_00970 interacts with host cell receptors or immune system components using pull-down assays or surface plasmon resonance.
Colonization models: Compare colonization efficiency between wild-type and HPSH_00970-deficient H. pylori strains in cell culture or animal models.
Immune response analysis: Evaluate host immune responses to purified HPSH_00970 protein using cytokine profiling and immune cell activation assays.
Drug target validation: Assess HPSH_00970 as a potential therapeutic target by screening small molecule inhibitors or antibodies that disrupt its function .
Biofilm formation: Investigate the role of HPSH_00970 in H. pylori biofilm development, which contributes to antibiotic resistance and persistent infection.
Post-translational modifications (PTMs) can significantly impact protein function. To investigate PTMs in HPSH_00970:
Mass spectrometry analysis: Perform LC-MS/MS on purified native HPSH_00970 from H. pylori to identify PTMs such as phosphorylation, glycosylation, or acetylation.
Site-directed mutagenesis: Create mutant versions where predicted modification sites are altered to amino acids that cannot be modified.
Modification-specific antibodies: Utilize antibodies that specifically recognize common PTMs to detect modified forms of HPSH_00970.
2D gel electrophoresis: Separate protein isoforms based on charge and mass differences resulting from PTMs.
In vitro modification assays: Test whether HPSH_00970 can serve as a substrate for known H. pylori modification enzymes.
Several challenges may arise when working with recombinant HPSH_00970:
Protein aggregation: If aggregation occurs after reconstitution, try reducing protein concentration, adding mild detergents (0.05% Tween-20), or optimizing buffer conditions (pH, salt concentration).
Loss of activity during storage: Minimize freeze-thaw cycles by creating single-use aliquots and ensure proper glycerol concentration (recommended 50%) for freezing .
Non-specific binding in assays: Include appropriate blocking agents (BSA, non-fat milk) and consider pre-clearing samples when performing immunoprecipitation or pull-down assays.
Precipitation during buffer exchange: Perform buffer exchanges gradually with stepwise dialysis or use spin concentrators with lower centrifugation speeds.
Batch-to-batch variation: Always include internal controls and standardize protein quantification methods across experiments.
To evaluate whether purified HPSH_00970 maintains its native structural properties:
Circular dichroism (CD) spectroscopy: Measure secondary structure content to confirm proper folding.
Size exclusion chromatography: Analyze elution profile to detect aggregation or oligomerization states.
Dynamic light scattering (DLS): Determine size distribution to identify potential aggregation.
Thermal shift assays: Assess protein stability under different buffer conditions using fluorescent dyes that bind to hydrophobic regions exposed during unfolding.
Activity assays: If function becomes known, develop functional assays to confirm biological activity as the ultimate measure of structural integrity.