Recombinant Helicosporidium sp. subsp. Simulium jonesii Probable sulfate transport system permease protein cysT (cysT)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Helicosporidium sp. subsp. Simulium jonesii cysT Protein

The recombinant Helicosporidium sp. subsp. Simulium jonesii probable sulfate transport system permease protein cysT is a truncated version of the native protein produced via heterologous expression in E. coli. This protein belongs to the SulT family of sulfate transporters, which are critical for sulfate uptake in both assimilatory and dissimilatory sulfate-reducing organisms. In Helicosporidium, a non-photosynthetic parasitic green alga, sulfate transport systems likely play roles in nutrient acquisition during parasitism, despite the loss of photosynthetic pathways .

Functional Role in Sulfate Transport

cysT functions as a permease component of the ABC transporter system (SulT family), which couples sulfate uptake to ATP hydrolysis. In Helicosporidium, this system likely facilitates sulfate acquisition from host environments, compensating for the loss of photosynthetic pathways .

SulT Family Components

The SulT system in Helicosporidium and other organisms includes:

ComponentFunctionExample Organisms
cysTPermease subunitHelicosporidium, E. coli
cysWPermease subunitE. coli, Salmonella
cysAATP-binding cassette (ABC) subunitE. coli, Bacillus subtilis
Sbp/CysPPeriplasmic sulfate/thiosulfate-binding proteinE. coli, Mycobacterium

In Helicosporidium, the absence of photosynthetic genes highlights the reliance on host-derived nutrients, making sulfate transport critical for survival .

Genetic and Regulatory Context

The cysT gene in Helicosporidium is transcriptionally regulated by conserved promoter motifs. A study identified a one-box motif (TAAWATGATT) upstream of cysT and cysA in Helicosporidium and other Viridiplantae, suggesting evolutionary conservation of sulfate metabolism regulation .

Conserved Promoter Motif

MotifSequenceRepeat CountOrganisms
TAAWATGATTTAAWATGATT1-3Helicosporidium, Chlorophyta

This motif is hypothesized to bind transcription factors, enabling coordinated expression of sulfate transport genes .

Organismal Background: Helicosporidium sp. subsp. Simulium jonesii

Helicosporidium is a non-photosynthetic parasitic alga infecting invertebrates (e.g., insects, crustaceans). Despite losing plastid genomes for photosynthesis, it retains vestigial plastids and genes for essential metabolic pathways, including sulfate transport .

Genome Features

ParameterValueComparison
Gene Density0.626 (genes/kbp)Higher than Chlorella (0.580)
Avg. Exon Size750 bpLarger than Chlamydomonas
Avg. Intron Size126 bpSmaller than Arabidopsis

The genome’s compact structure and retention of sulfate transport genes underscore adaptations for parasitism .

Research Applications and Significance

The recombinant cysT protein is valuable for:

  1. Structural Studies: Elucidating the mechanism of sulfate permease activity in parasitic algae.

  2. Functional Assays: Testing substrate specificity (e.g., sulfate vs. thiosulfate) using reconstituted membrane systems.

  3. Comparative Genomics: Mapping evolutionary divergences in sulfate transport systems between Helicosporidium and photosynthetic algae .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
cysT; Probable sulfate transport system permease protein cysT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-270
Protein Length
full length protein
Species
Helicosporidium sp. subsp. Simulium jonesii (Green alga)
Target Names
cysT
Target Protein Sequence
MGNFILHPIQSRLIVISYSILILILPLYALFSYASNASWSLILEKATDPIAVAAYTLTIK MALYTAIINTIFGFIIAWVLTRYNFSGKRIMDAIVDLPLALPTSVAGLALSTVFGRNGLF GHILDFYNYEIIYTKRGILLAMIFVSFPFSVRAIQPILKEINKEEEEAAWSLGSGPLETF KRFIFPIILPAILNGFTLTFSRSLSEFGSIVMVAGNLPLQDLVSSVLISQYLEQYDYIGA CVISIIVLMLACSVLLFVQIIHSLVVVDSK
Uniprot No.

Target Background

Function

The protein is part of the ABC transporter complex cysAWTP (TC 3.A.1.6.1), involved in sulfate/thiosulfate import. It is likely responsible for substrate translocation across the membrane.

Protein Families
Binding-protein-dependent transport system permease family, CysTW subfamily
Subcellular Location
Plastid membrane; Multi-pass membrane protein.

Q&A

What is the Helicosporidium sp. cysT protein and what is its function?

The cysT protein in Helicosporidium sp. subsp. Simulium jonesii is a probable sulfate transport system permease protein consisting of 270 amino acids. It functions as a transmembrane component that facilitates the movement of sulfate ions across cellular membranes. In sulfate transport systems, cysT typically operates within the SulT system, interacting with the periplasmic sulfate binding protein (Sbp) and another permease component CysW to form a functional transport complex . This system is essential because sulfate ions cannot enter cells through passive diffusion and require specialized transport mechanisms .

The cysT gene is uniquely maintained in the plastid genome of Helicosporidium, while other components of the metabolic pathways in which it participates are known to be encoded in the nuclear genome . This distribution between genomic compartments highlights the protein's importance in the organism's metabolic network.

What is the evolutionary significance of the cysT gene in Helicosporidium sp.?

The presence of the cysT gene in the plastid genome of Helicosporidium sp. has significant evolutionary implications. Helicosporidium is a nonphotosynthetic green alga that has lost its photosynthetic capability but retained a functional plastid genome . The retention of certain genes in the plastid genome, including cysT, suggests these genes play essential roles that have been maintained despite the evolutionary shift to a parasitic lifestyle.

Recent phylogenetic studies have revealed that Helicosporidium nests within the genus Prototheca, forming a clade with Prototheca wickerhamii with 80% posterior probability . This positioning provides insights into the evolutionary trajectory of these nonphotosynthetic organisms and their retained plastid functions. Comparative analysis of reduced plastid genomes in colorless facultative pathogens like Helicosporidium reveals patterns of gene retention and loss that illuminate the minimum required functions of a non-photosynthetic plastid .

What methodologies are used to culture and maintain Helicosporidium sp. for cysT research?

Helicosporidium sp. (ATCC 50920, isolated from the blackfly Simulium jonesii) can be cultured axenically in laboratory conditions using the following protocol:

  • Growth medium: TNM-FH insect medium (Sigma-Aldrich) supplemented with 5% fetal bovine serum and 50 mg/ml of gentamycin

  • Culture conditions: 25°C in the dark

  • Cell harvesting: Centrifugation followed by grinding under liquid nitrogen

  • DNA extraction: Using commercial kits such as the Plant Dneasy Mini Kit (Qiagen)

For studies specifically focusing on cyst morphogenesis, which cannot currently be induced in vitro, researchers use in vivo systems with invertebrate hosts. Studies have shown that cyst production in Helicosporidium occurs between 7-13 days after infection in heterologous hosts like Helicoverpa zea larvae . Host age at infection and cyst dosage significantly influence pathogenicity and cyst production, with moderate cyst dosages and later host ages being most effective for regenerating Helicosporidium cysts .

How does cysT contribute to Helicosporidium's metabolic pathways?

The cysT protein, as part of the sulfate transport system, plays a crucial role in Helicosporidium's metabolism by enabling the uptake of sulfate ions, which are essential for various biochemical processes. In parasitic organisms like Helicosporidium, efficient nutrient acquisition from the host environment is critical for survival and reproduction.

The sulfate transport system exemplifies the functional diversity of Helicosporidium's cryptic plastid . While the organism has lost photosynthetic capability, it has retained plastid-encoded functions related to other metabolic processes. The coordination between plastid-encoded components (like cysT) and nucleus-encoded components of the same metabolic pathways represents an interesting aspect of the organism's adaptation to parasitism .

This distribution of metabolic functions between different cellular compartments suggests that the sulfate transport system remains essential despite the evolutionary transition to parasitism, potentially supporting processes such as sulfur-containing amino acid synthesis, sulfate assimilation, or other metabolic pathways requiring sulfur compounds.

What are the optimal conditions for functional expression of recombinant Helicosporidium cysT protein?

Based on available information, recombinant Helicosporidium sp. subsp. Simulium jonesii cysT protein has been successfully expressed in E. coli with an N-terminal His tag . For researchers seeking to express functional cysT protein, the following methodological considerations are recommended:

Expression System Parameters:

ParameterRecommended ConditionsJustification
Expression HostE. coliProven success with this host
Vector TypepET or similar with His-tagEnables purification via metal affinity chromatography
Fusion TagN-terminal His tagDemonstrated successful expression
Growth Temperature37°C initially, reduced to 18-25°C post-inductionSlower expression improves membrane protein folding
InductionIPTG at 0.1-0.5 mMLower concentrations minimize toxicity
Culture Duration16-24 hours post-inductionAllows time for proper folding
Media SupplementsConsider glycerol (1-2%)Stabilizes membranes

Post-Expression Processing:

  • Cell lysis using mechanical disruption (e.g., tissue lyser with glass beads as performed for Helicosporidium DNA extraction)

  • Membrane fraction isolation via differential centrifugation

  • Solubilization with appropriate detergents (e.g., Triton-X100, SDS as used in extraction protocols)

  • Purification via metal affinity chromatography

For long-term storage, the purified protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL with 5-50% glycerol added for storage at -20°C/-80°C . Repeated freeze-thaw cycles should be avoided to maintain protein integrity .

How can researchers assess the functional activity of recombinant cysT protein?

Assessing the functional activity of recombinant cysT requires specialized approaches due to its role as a membrane transport protein. The following methodological strategies are recommended:

Liposome Reconstitution Assay:

  • Purify recombinant cysT to >90% purity as verified by SDS-PAGE

  • Prepare liposomes from suitable phospholipids (e.g., E. coli total lipid extract)

  • Reconstitute purified cysT into liposomes using detergent removal methods

  • Load liposomes with fluorescent indicators sensitive to sulfate concentration

  • Measure fluorescence changes upon addition of external sulfate

  • Compare with control liposomes lacking cysT

Complementation Studies:

  • Identify or create sulfate transport-deficient bacterial strains

  • Transform with vectors expressing Helicosporidium cysT

  • Assess growth restoration on media where sulfate transport is essential

  • Compare with positive controls (known functional transporters) and negative controls

Isotope Flux Measurements:

  • Reconstitute cysT in liposomes or express in suitable cellular systems

  • Incubate with radiolabeled sulfate (35S-sulfate)

  • Measure uptake kinetics using filtration or centrifugation to separate transported from free sulfate

  • Determine transport parameters (Km, Vmax) under varying conditions

These functional assays should be combined with structural verification methods such as circular dichroism to confirm proper protein folding before concluding about functional capacity.

What experimental approaches are recommended for studying cysT protein interactions with other components of the sulfate transport system?

As a permease component of the sulfate transport system, cysT interacts with the periplasmic sulfate binding protein (Sbp) and another permease component CysW . Characterizing these interactions requires specialized approaches:

Co-purification Studies:

  • Co-express His-tagged cysT with potential interaction partners

  • Perform tandem affinity purification

  • Analyze co-purified proteins by mass spectrometry

  • Verify specific interactions through control experiments

Crosslinking Mass Spectrometry:

  • Treat purified complexes or membrane preparations with crosslinkers

  • Digest crosslinked proteins and analyze by LC-MS/MS

  • Identify crosslinked peptides to map interaction interfaces

  • Build structural models based on crosslinking constraints

Functional Reconstitution:

ComponentsExpected OutcomeAnalysis Method
cysT aloneMinimal transportIsotope flux assay
cysT + SbpEnhanced substrate bindingBinding assay
cysT + CysWImproved channel formationElectrophysiology
cysT + Sbp + CysWFull transport activityCombined assays

Microscopy-based Interaction Analysis:

  • Label cysT and potential partners with different fluorescent tags

  • Express in suitable cell systems

  • Analyze co-localization and potentially use FRET to confirm direct interactions

  • Complement with split-GFP or BiFC approaches for verification

These approaches would provide complementary data on both physical interactions and functional relationships between cysT and other components of the sulfate transport machinery in Helicosporidium.

How does the sequence and function of Helicosporidium cysT compare to homologous proteins in related organisms?

Comparative analysis of cysT from Helicosporidium with homologous proteins provides insights into functional conservation and adaptation. The following comparative framework is recommended:

Sequence Comparison Table:

OrganismProtein LengthSequence Identity to Helicosporidium cysTKey Conserved Motifs
Helicosporidium sp.270 aa100%Transmembrane domains
Prototheca wickerhamiiVariesLikely low (<25%)Membrane-spanning regions
Chlorella spp.VariesLikely low (<25%)Substrate binding sites
E. coli CysTVariesLikely low (<25%)Interaction domains

Despite low sequence identity (typically in the "twilight zone" of ≤25%) , these proteins likely share structural similarities due to the constraints of membrane protein architecture and transport function. The relationship between Helicosporidium and Prototheca is particularly relevant given their phylogenetic proximity, with Helicosporidium nesting within the Prototheca genus with a 100% posterior probability .

Functional Comparison:

  • Substrate specificity: Whether restricted to sulfate or capable of transporting related ions

  • Transport mechanism: ABC-type versus other transport mechanisms

  • Regulation: How transport activity is controlled in different organisms

  • Integration with metabolism: Connections to downstream pathways

Based on available information, it appears that while Helicosporidium and other sulfate-reducing microorganisms contain putative sulfate transporters from several protein families (SulP, DASS, CysP, and CysZ), there is not strong evidence that ABC-type transporters (SulT) are involved in sulfate uptake in sulfate-reducing microorganisms . This suggests potential differences in transport mechanisms between Helicosporidium and other organisms.

What are the current challenges and future directions in researching Helicosporidium cysT?

Research on Helicosporidium cysT faces several significant challenges while also offering promising future directions:

Current Methodological Challenges:

  • Cultivation and Life Cycle Complexity:

    • Helicosporidium requires specialized culture conditions

    • Cyst morphogenesis occurs in infected hosts but cannot currently be induced in vitro

    • Host age and pathogen dosage impact cyst morphogenesis

  • Protein Expression and Purification:

    • Membrane proteins like cysT are inherently difficult to express in functional form

    • Maintaining native structure during purification requires specialized approaches

    • Current protocols provide basic reconstitution methods but may need optimization

  • Functional Characterization:

    • Direct measurement of transport activity requires specialized assays

    • Reconstitution into functional complexes with interaction partners remains challenging

    • Correlation between in vitro and in vivo function needs validation

Future Research Directions:

Research AreaMethodological ApproachExpected Outcome
Structure DeterminationCryo-EM of purified proteinMolecular mechanism of transport
In vivo FunctionDevelopment of genetic tools for HelicosporidiumDirect evidence of physiological role
Metabolic IntegrationSystems biology approachesMap of sulfate utilization pathways
Comparative AnalysisGenomics and functional studies across taxaEvolutionary patterns of transport
Host-Parasite InteractionsTranscriptomics during infectionRole in virulence and adaptation

Particularly promising is the integration of structural studies with functional characterization to understand how this membrane protein contributes to the unique lifestyle of this parasitic alga. The relationship between cysT function and the organism's pathogenicity in invertebrate hosts could reveal novel aspects of host-parasite biochemical interactions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.