Recombinant Heliobacterium modesticaldum Cytochrome b6 (petB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing the order. We will strive to fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
petB; cytB; Helmi_12290; HM1_0698; Cytochrome b6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-213
Protein Length
full length protein
Species
Heliobacterium modesticaldum (strain ATCC 51547 / Ice1)
Target Names
petB
Target Protein Sequence
MNWLEERMPGIGRIAKDIAEHPVPSHTLNIFYCLGGLTLLCFIIQCLTGVFLAFYYKPTP EAAFASVQMITNEVRFGSVIRSMHHWSCQLMILLVFLHMLRVYYTGAFKKPRELNWVAGC FLLVLSLGLAFTGYLLPYEQLSYWASVIGAETANTLPVIGPTLKIMMQGGIKVTAEMLSR FYVLHVMILPAITIGFLVAHFIMIRVQGISDPM
Uniprot No.

Target Background

Function
Cytochrome b6 (petB) is a component of the cytochrome bc complex, which plays a crucial role in electron transfer to the photosynthetic reaction center.
Database Links
Protein Families
Cytochrome b family, PetB subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What growth conditions are optimal for cultivating Heliobacterium modesticaldum?

Heliobacterium modesticaldum requires specific growth conditions for optimal cultivation. The organism grows best at 50°C under anaerobic conditions with illumination, typically using 790-nm LED lighting. When cultivating H. modesticaldum on solid media, CO₂ supplementation is critical - cells fail to form colonies without CO₂ in the atmosphere, which was an unexpected discovery made fortuitously during research .

For liquid cultures, modified Pyruvate Yeast Extract (mPYE) medium is commonly used. When working with solid media, plates should be pre-warmed to 50°C before plating to maintain optimal growth conditions. For cultivation on agar plates, placing them in clear sealable bags and incubating at 50°C under illumination provides suitable conditions .

Nutritionally, H. modesticaldum demonstrates several interesting requirements. Initial studies showed that when grown in media lacking vitamin B12 (cobalamin), cells initially display a pink color due to the lack of photosynthetic pigments, though in subsequent subcultures, the normal brown color returns as cells adapt to synthesize their own vitamin B12 .

What antibiotics are effective for selection in H. modesticaldum transformation experiments?

Selection of appropriate antibiotics is crucial for successful transformation experiments. H. modesticaldum demonstrates varying sensitivity to different antibiotics, with minimal inhibitory concentrations (MICs) as follows:

AntibioticMIC (μg/mL)Notes
AmpicillinVery lowOrganism is highly sensitive to penicillin derivatives
TetracyclineLower than spectinomycinMore effective than other aminocyclitols
ThiamphenicolMuch lower than chloramphenicolMore effective than structurally related compounds
Apramycin10-15Similar to kanamycin
Kanamycin10-15Good choice for selection
ErythromycinModerateGood choice, thermostable at 50°C
Streptomycin>400Not recommended due to spontaneous resistance

For selection experiments, erythromycin, kanamycin, and chloramphenicol are recommended due to their commercial availability, moderate MICs, lack of spontaneous resistance, and thermostability at 50°C . Notably, streptomycin should be avoided as a selectable marker in heliobacteria due to the frequent occurrence of spontaneous resistance .

How is genetic transformation achieved in H. modesticaldum?

Genetic transformation of H. modesticaldum has historically been challenging. Initial attempts using electroporation, natural transformation, or conjugation were unsuccessful. The breakthrough came from addressing DNA restriction after entry into the heliobacterial cell .

The successful transformation protocol involves:

  • Pre-methylation of plasmid DNA using specific DNA methyltransferases (DMTs) to protect it from restriction enzymes

  • Conjugation with E. coli as the donor strain

  • Specific treatment steps to optimize conjugation efficiency:

    • Use of a DMT helper vector (pPB347) containing five heliobacterial DMT genes under the arabinose-inducible promoter

    • Careful selection of mobile vectors transferable to members of the Clostridiales

    • Implementation of a specific conjugation protocol involving the drying of bacterial suspension onto agar plugs

    • Incubation at 37°C or 42°C overnight under 790-nm LED lighting

The conjugation protocol involves spotting and drying the bacterial suspension onto a 2% agar-mPYE plug, inverting and incubating the plate at the appropriate temperature, then scraping cells from the agar plug and resuspending them before plating on selective media .

What are the vitamin and nutrient requirements for culturing H. modesticaldum?

H. modesticaldum has specific nutritional requirements that must be addressed for successful cultivation. The organism requires:

  • Pyruvate as a carbon source in minimal media (Pyruvate Minimal Salts medium)

  • Supplementation with trace elements including Na₂SeO₃ (12.5 nM), FeSO₄ (20 μM), and Na₂S₂O₃ (1 mM)

  • Various vitamins, with interesting dependencies:

    • Biotin (vitamin B7) is required

    • Vitamin B12 (cobalamin) appears initially essential but cells can adapt to produce it

The vitamin dependency is particularly noteworthy for photosynthesis research. When H. modesticaldum cells are grown without vitamin B12, they initially appear pink due to lack of photosynthetic pigments and achieve lower late-log phase density. This is likely because the dark-operative protochlorophyllide oxidoreductase (DPOR), key in anaerobic biosynthesis of bacteriochlorophyll, contains a cobalamin prosthetic group derived from vitamin B12 .

Interestingly, after subsequent subcultures, the normal brown color returns, indicating that native biosynthesis of B12 and bacteriochlorophyll g recovers after a period of adaptation .

How can DNA restriction be overcome in H. modesticaldum transformation?

Overcoming DNA restriction is a critical challenge in transforming H. modesticaldum. Restriction of foreign DNA by endogenous restriction enzymes (REs) was identified as the primary barrier to successful transformation .

The solution involved a systematic approach:

  • Identification of active restriction-modification systems through REBASE database analysis

  • Selection of DNA methyltransferase (DMT) genes based on transcript detection and proximity to restriction enzyme genes

  • Construction of a DMT helper vector (pPB347) containing five heliobacterial DMT genes

  • Expression of these DMTs in E. coli to pre-methylate the DNA prior to transformation

The selection criteria for DMT genes were:

  • Non-negligible transcript reads (RPKM >3) in published transcriptome data

  • Location within four open reading frames of a gene encoding a restriction enzyme

  • Likelihood of methylating the same recognition sequence as the restriction enzyme

The selected genes (HM1_2858, HM1_3004, HM1_3037, HM1_3076, and HM1_3075) were cloned into plasmid pBAD33 under the arabinose-inducible promoter, creating the pPB347 helper vector. This vector allows low-level expression of the DMTs in E. coli through promoter leakiness .

This approach demonstrates the importance of understanding and addressing the specific restriction-modification systems of the target organism in recombinant protein work.

What role does the PshX subunit play in the photochemical reaction center and how might this impact studies of Cytochrome b6?

The PshX subunit plays a crucial role in the photochemical reaction center of H. modesticaldum. Recent research has revealed that:

  • The heliobacterial reaction center (HbRC) consists of a homodimer of PshA polypeptide and two copies of the PshX polypeptide

  • PshX is a single transmembrane helix that binds two bacteriochlorophyll g molecules

  • The bacteriochlorophylls bound by PshX have the lowest site energies in the entire HbRC

  • PshX functions as a low-energy antenna subunit, participating in entropy-assisted uphill energy transfer toward the P₈₀₀ special bacteriochlorophyll g pair

To assess PshX function, researchers produced a ΔpshX strain using the endogenous Type I-A CRISPR-Cas system to aid in mutant selection. The system was optimized by separating homologous recombination and CRISPR-based selection into two plasmid transformations, enabling markerless gene replacement .

For researchers working with Cytochrome b6, understanding the energy transfer dynamics involving PshX is crucial because Cytochrome b6 (part of the Cytochrome b6f complex) participates in the electron transport chain downstream of the reaction center. Alterations in energy transfer efficiency at the reaction center level could impact electron flow to the Cytochrome b6f complex, affecting experimental outcomes in recombinant studies.

What CRISPR-Cas strategies can be employed for genetic manipulation of H. modesticaldum?

H. modesticaldum possesses an endogenous Type I-A CRISPR-Cas system that can be leveraged for genetic engineering. Researchers have successfully optimized this system for gene manipulation through a two-step approach:

  • Homologous recombination to introduce the desired genetic changes

  • CRISPR-based selection to eliminate non-modified cells

The key innovation was separating these steps into two plasmid transformations, which allowed for markerless gene replacement. This approach was successfully applied to create a ΔpshX strain of H. modesticaldum for studying the function of the PshX subunit .

For researchers working with Cytochrome b6 (petB), this CRISPR-Cas strategy offers several advantages:

  • Markerless modifications prevent potential interference from antibiotic resistance genes

  • Precise editing capabilities allow for studying specific domains or residues within the Cytochrome b6 protein

  • The system can be adapted for various genetic manipulations including gene deletion, insertion, or point mutations

When applying this approach to Cytochrome b6 studies, researchers should design homology arms flanking the petB gene region of interest and appropriate CRISPR guides targeting sequences that would be altered or removed by the genetic modification.

What techniques are effective for isolating intact plasmid DNA from H. modesticaldum?

Isolating intact plasmid DNA from H. modesticaldum presents unique challenges due to the presence of DNase enzymes, some of which may be associated with the cell wall. Research has shown that special precautions are necessary:

  • DNase enzymes must be inactivated prior to cell lysis

  • A multi-component approach is required, including:

    • Addition of lysozyme to hydrolyze glycosidic bonds of peptidoglycans and degrade the cell wall

    • Simultaneous use of DEPC (diethyl pyrocarbonate) and EDTA to inactivate DNases

    • Careful timing of these treatments to prevent DNA degradation

This treatment significantly improves both quality and quantity of isolated plasmid DNA, supporting the hypothesis that heliobacterial DNases associated with the cell wall degrade plasmid DNA during standard isolation procedures .

For researchers working with recombinant Cytochrome b6 constructs, this optimized plasmid isolation protocol is critical for verifying plasmid integrity, confirming successful transformations, and recovering expression vectors for subsequent experiments or modifications.

How should expression systems be designed for recombinant Cytochrome b6 in H. modesticaldum?

Designing expression systems for recombinant Cytochrome b6 in H. modesticaldum requires careful consideration of several factors based on the molecular biology toolkit established for this organism:

  • Vector selection should prioritize:

    • Compatibility with the conjugation-based transformation system

    • Appropriate antibiotic resistance markers (erythromycin, kanamycin, or chloramphenicol)

    • Promoters functional in H. modesticaldum

  • Special considerations for Cytochrome b6 as a membrane protein:

    • Use of native promoter elements may help ensure proper expression levels

    • Inclusion of the complete operon structure may be necessary for proper assembly of the Cytochrome b6f complex

    • Consideration of codon optimization based on H. modesticaldum preferences

  • Verification strategy:

    • Plan for spectroscopic analysis to confirm proper incorporation of heme groups

    • Consider epitope tagging approaches that won't interfere with membrane insertion or function

For optimal results, researchers should first confirm successful expression of the native petB gene under experimental conditions before attempting modifications or heterologous expression variants.

What analytical methods are most effective for characterizing recombinant Cytochrome b6 in H. modesticaldum?

Characterization of recombinant Cytochrome b6 in H. modesticaldum requires a combination of biochemical, spectroscopic, and functional approaches:

  • Spectroscopic analysis:

    • Absorption spectroscopy to verify characteristic peaks of properly folded and heme-containing Cytochrome b6

    • Low-temperature absorbance measurements to detect subtle changes in spectral properties

    • Fluorescence spectroscopy to assess energy transfer dynamics

  • Functional characterization:

    • Electron transport measurements to confirm functional integration into the photosynthetic apparatus

    • Comparison of photosynthetic growth rates between wild-type and recombinant strains

  • Biochemical verification:

    • Membrane fractionation followed by SDS-PAGE and immunoblotting

    • Mass spectrometry to confirm protein identity and post-translational modifications

The analytical approach should be designed with awareness of the unique photosynthetic pigments in H. modesticaldum (bacteriochlorophyll g), which may influence spectral measurements and require adjustment of standard protocols used for other photosynthetic bacteria.

How can low transformation efficiency in H. modesticaldum be improved?

Low transformation efficiency is a common challenge when working with H. modesticaldum. Based on the available research, several strategies can improve results:

  • Optimization of DNA methylation:

    • Ensure proper expression of all five DMT genes in the helper plasmid

    • Consider extended incubation time for complete methylation

    • Verify methylation status using restriction digestion tests before transformation

  • Conjugation protocol refinements:

    • Test different conjugation temperatures (37°C vs. 42°C)

    • Optimize donor:recipient ratios in the mating mixture

    • Extend conjugation incubation time when working with larger constructs

  • Recipient cell preparation:

    • Use cells in mid-logarithmic growth phase

    • Ensure cells are cultured under optimal conditions prior to conjugation

    • Consider heat shock or other stress treatments that might temporarily reduce restriction activity

Researchers working with Cytochrome b6 constructs should be particularly attentive to plasmid size, as larger constructs (which might include the complete cytochrome b6f operon) typically transform with lower efficiency and may require extended conjugation times.

What strategies can address poor expression or misfolding of recombinant Cytochrome b6?

Cytochrome b6 is a membrane protein with complex folding requirements and cofactor incorporation. When expression or folding issues arise, consider these approaches:

  • Expression level optimization:

    • Test different promoter strengths

    • Use inducible systems to control expression timing and level

    • Consider growth temperature adjustment during expression phase

  • Cofactor availability:

    • Supplement growth media with potential limiting factors (iron sources for heme biosynthesis)

    • Consider co-expression of proteins involved in cofactor attachment or membrane insertion

  • Protein engineering approaches:

    • Generate fusion constructs with well-expressed heliobacterial membrane proteins

    • Create chimeric proteins incorporating the transmembrane domains from native H. modesticaldum proteins

    • Test truncated versions focusing on specific domains of interest

  • Cultivation conditions:

    • Modify light intensity during expression, as photosynthetic complexes are often regulated by light

    • Adjust media composition to reduce stress on the protein expression machinery

When troubleshooting, an incremental approach testing one variable at a time will help identify the specific factors affecting recombinant Cytochrome b6 expression.

How might the evolutionary relationship between Cytochrome b6 and other photosynthetic complexes in H. modesticaldum inform protein engineering approaches?

The evolutionary relationships between photosynthetic complexes in H. modesticaldum offer valuable insights for protein engineering:

  • Comparative analysis considerations:

    • H. modesticaldum possesses a homodimeric Type I reaction center, unlike the heterodimeric centers in many other phototrophs

    • PshX subunit conservation and location parallels similar single-transmembrane helix subunits in other reaction centers, suggesting convergent evolution

    • These relationships can guide rational design of chimeric photosynthetic proteins

  • Potential protein engineering strategies:

    • Creation of fusion proteins between Cytochrome b6 and components of the reaction center to study electron transfer dynamics

    • Generation of simplified minimal functional units based on evolutionary conservation analysis

    • Development of novel electron transport pathways by rewiring connections between Cytochrome b6 and ancestrally related complexes

Understanding the evolutionary pressure to produce and maintain single-transmembrane helix subunits (like PshX) in various reaction centers provides a blueprint for engineering similar elements in recombinant Cytochrome b6 constructs .

What implications do the unique photosynthetic properties of H. modesticaldum have for heterologous expression of Cytochrome b6?

H. modesticaldum possesses several unique photosynthetic properties that must be considered when expressing Cytochrome b6 heterologously:

  • Pigment considerations:

    • H. modesticaldum uses bacteriochlorophyll g rather than the more common bacteriochlorophyll a

    • The reaction center possesses unusual low-energy antenna chlorophylls bound by PshX

    • These spectral differences affect energy transfer to and from Cytochrome b6f

  • Electron transport chain adaptation:

    • The unique arrangement of energy levels in the H. modesticaldum photosystem may require co-expression of additional components

    • Heterologous systems may need adjustment to accommodate the different redox potentials of the H. modesticaldum electron transport chain

  • Experimental design implications:

    • Spectroscopic measurements must account for the red-shifted absorption properties of bacteriochlorophyll g

    • Functional assays should consider the unique electron flow patterns in heliobacterial photosynthesis

    • Expression in other hosts may require supplementation with specific cofactors or assembly factors

These considerations highlight the importance of understanding the native context of Cytochrome b6 when designing heterologous expression systems or interpreting functional data from recombinant constructs.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.