Recombinant Heliobacterium modesticaldum Energy-coupling factor transporter transmembrane protein EcfT (ecfT)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we have in stock. However, if you have specific requirements for the format, please indicate them when placing the order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have specific tag type requirements, please inform us, and we will prioritize the development of the specified tag.
Synonyms
ecfT; Helmi_13630; HM1_1411; Energy-coupling factor transporter transmembrane protein EcfT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-266
Protein Length
full length protein
Species
Heliobacterium modesticaldum (strain ATCC 51547 / Ice1)
Target Names
ecfT
Target Protein Sequence
MLKDITLGQYVPLDSPVHRLDPRTKVIATLLFSIALFLLPTLRSVTLAGLPIIIAIVATR LPIHYILRGIKPLWIFIVFTLLVHLLSTPGETAVRLGPFAITWEGLRQGAMVSQRLIWLY AATSLLTLTTSPIALTDGLELLLSPGKRIGLPVHEFAMMTSIALRFIPTLIEETEKIMKA QSSRGADFDSGSLVARVKSLVPLMVPLLLSAFRRADELAMAMEARCYRGGEGRTRMRPLV MSGKDYAVTVAVSGVFILICLWKKAL
Uniprot No.

Target Background

Function
Transmembrane (T) component of an energy-coupling factor (ECF) ABC-transporter complex. Unlike classic ABC transporters, this ECF transporter provides the energy required for the transport of a variety of substrates.
Database Links
Protein Families
Energy-coupling factor EcfT family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the Energy-coupling factor transporter transmembrane protein EcfT in Heliobacterium modesticaldum?

The Energy-coupling factor (ECF) transporter transmembrane protein EcfT is a critical component of the ECF transporter complex in H. modesticaldum, a gram-positive nitrogen-fixing phototrophic bacterium that exhibits metabolic specialization . EcfT functions as the transmembrane component of ECF transporters, which belong to a subclass of ATP-binding cassette (ABC) transporters. In H. modesticaldum, this protein likely plays an essential role in nutrient acquisition, particularly in the context of the organism's limited carbon metabolism capacity. The protein is identified by the accession number B0TC89 and is being studied in recombinant form to understand its structural and functional properties .

How does the EcfT protein relate to Heliobacterium modesticaldum's unique metabolic characteristics?

H. modesticaldum possesses a notably specialized metabolism with limited capacity for carbon assimilation, as revealed by its complete genome sequence . The organism can grow either photoheterotrophically or chemotrophically but lacks the genetic machinery for photoautotrophic growth . Within this restricted metabolic framework, membrane transporters like EcfT are critical for nutrient acquisition. The EcfT protein likely facilitates the transport of essential micronutrients (such as vitamins or trace elements) that complement H. modesticaldum's limited carbon metabolism pathways, which include photoassimilation of pyruvate, lactate, or acetate . This transport function becomes particularly important considering that H. modesticaldum lacks several key enzymes for autotrophic carbon fixation, including citrate lyase, which distinguishes its metabolism from other phototrophic bacteria .

What expression systems are most effective for producing recombinant H. modesticaldum EcfT protein?

For successful expression of recombinant H. modesticaldum EcfT protein, E. coli-based expression systems with T7 promoter-driven expression (such as pET series vectors) often yield good results for prokaryotic membrane proteins. When designing an expression strategy for EcfT, researchers should consider that H. modesticaldum is a gram-positive bacterium with a low G+C content , which may affect codon usage optimization in expression hosts.

For membrane proteins like EcfT, expression conditions should be carefully optimized to prevent protein aggregation and misfolding. Using lower induction temperatures (15-25°C), reduced inducer concentrations, and specialized E. coli strains (such as C41/C43(DE3) or Lemo21(DE3)) can significantly improve the yield of properly folded protein. For functional studies, consider co-expression with other components of the ECF transporter complex, as EcfT functions as part of a multiprotein assembly in its native environment.

What purification strategies yield functional EcfT protein suitable for structural and biochemical studies?

A recommended protocol involves:

  • Membrane preparation from expression host cells through differential centrifugation

  • Solubilization using mild detergents (DDM, LMNG, or DMNG at 1-2% concentration)

  • IMAC purification with detergent concentration maintained above critical micelle concentration

  • Size exclusion chromatography for final polishing and buffer exchange

For functional studies, reconstitution into proteoliposomes or nanodiscs may be necessary to maintain native-like lipid environment. When designing reconstitution experiments, consider using lipid compositions that mimic the membrane environment of H. modesticaldum, which as a heliobacterium likely has distinct membrane characteristics compared to other bacteria.

How does EcfT transport activity correlate with H. modesticaldum's energy metabolism?

EcfT transport activity is likely intimately connected to H. modesticaldum's distinctive energy metabolism. H. modesticaldum can grow photoheterotrophically using light energy or chemotrophically in darkness . To investigate this correlation, researchers should establish transport assays under both photosynthetic and non-photosynthetic conditions.

A methodological approach would include:

  • Reconstituting purified EcfT (preferably with other ECF components) into liposomes

  • Loading liposomes with potential substrates (labeled vitamins or micronutrients)

  • Measuring transport rates under varying energy conditions:

    • In the presence of ATP (direct energization)

    • Under conditions mimicking photosynthetic electron transport (using artificial electron donors)

    • With pyruvate or other carbon sources utilized by H. modesticaldum

Experimental evidence indicates that H. modesticaldum obtains energy through substrate-level phosphorylation, as demonstrated by the activity of phosphoenolpyruvate carboxykinase (PEP + ADP + CO₂ → OAA + ATP) . Investigating whether EcfT transport is enhanced under conditions that promote ATP generation through this pathway would provide valuable insights into how the protein's function is integrated with the organism's energy metabolism.

What is the relationship between EcfT function and H. modesticaldum's photosynthetic electron transfer chain?

The relationship between EcfT function and H. modesticaldum's photosynthetic apparatus presents an intriguing research question. H. modesticaldum possesses a unique photosynthetic reaction center with symmetric electron transfer along two identical branches with C2 symmetry . This symmetrical electron transfer distinguishes heliobacteria from other type-I reaction centers.

To investigate potential functional relationships, researchers should:

  • Examine EcfT expression levels under different light conditions

  • Test whether transport activity is enhanced during photosynthetic electron transfer

  • Investigate if EcfT-mediated transport is affected by inhibitors of the photosynthetic electron transfer chain

The primary electron donor in H. modesticaldum is P800, formed by two bacteriochlorophyll g' cofactors, with electron transfer proceeding to acceptors A0 and 81-OH-Chl aF, and ultimately to the 4Fe-4S cluster Fx . Researchers should explore whether the energetics of this electron transfer pathway indirectly supports EcfT-mediated transport through enhanced ATP production or membrane potential generation.

How do specific amino acid residues in EcfT contribute to substrate specificity and transport mechanism?

Determining how specific amino acid residues in EcfT contribute to substrate specificity requires a combination of structural analysis and functional assays. While specific structural information about H. modesticaldum EcfT is limited in the provided search results, researchers can employ several approaches:

  • Homology modeling based on structurally characterized ECF transporters

  • Site-directed mutagenesis targeting:

    • Conserved residues in transmembrane helices

    • Residues at the interface with other ECF components

    • Potential substrate-binding sites identified through computational predictions

  • Transport assays with purified wild-type and mutant proteins reconstituted into liposomes

  • Binding assays using isothermal titration calorimetry or microscale thermophoresis

Results should be interpreted in the context of H. modesticaldum's specialized metabolism. For instance, given the organism's reliance on specific carbon sources like pyruvate, lactate, and acetate , researchers should investigate whether EcfT might be specialized for transporting cofactors or nutrients that complement these metabolic restrictions.

What role does EcfT play in H. modesticaldum's adaptation to its ecological niche?

H. modesticaldum was isolated from Icelandic hot spring volcanic soils , suggesting adaptation to a specific ecological niche. The role of EcfT in this adaptation deserves investigation through:

  • Comparative genomic analysis of ECF transporters across heliobacteria from different environments

  • Expression studies of EcfT under conditions mimicking natural habitat (temperature, pH, nutrient availability)

  • Transport assays with potential substrates available in the organism's natural environment

Given that H. modesticaldum shows a notable degree of metabolic specialization and genomic reduction , EcfT might be essential for acquiring specific nutrients scarce in its environment. H. modesticaldum cannot grow photoautotrophically despite having nearly all genes required for the reverse tricarboxylic acid cycle (rTCA), lacking only ATP citrate lyase . This metabolic limitation might increase reliance on transporters like EcfT for acquiring essential compounds that the organism cannot synthesize.

How is EcfT expression regulated in response to changing nutrient availability?

Investigation of EcfT expression regulation requires experimental approaches that assess transcriptional and translational control mechanisms:

  • Quantitative RT-PCR analysis of ecfT gene expression under varying nutrient conditions

  • Reporter gene assays to identify promoter elements and regulatory factors

  • Proteomic analysis to compare EcfT protein levels across growth conditions

H. modesticaldum can assimilate D-fructose (20-25%, 8-10 mM) and D-glucose (~10%, ~4 mM) , showing better growth on D-fructose. Researchers should examine whether EcfT expression changes when the organism is grown on different carbon sources, which might indicate coordinated regulation between carbon metabolism and micronutrient acquisition systems.

Enzymatic activities of hexokinase (10 nmole/min- mg protein), 6-phosphofructokinase (20 nmole/min- mg protein), and pyruvate kinase (10 nmole/min- mg protein) have been detected in hexose-grown cultures , suggesting active regulation of metabolic enzymes. Similar regulatory mechanisms might control EcfT expression in response to changing nutrient conditions.

What techniques can be employed to study EcfT-mediated transport in intact H. modesticaldum cells?

Studying EcfT-mediated transport in intact cells presents technical challenges but offers insights into physiological function. Researchers should consider:

  • Development of fluorescent or radioactive substrate analogs that can be traced in transport assays

  • Creation of ecfT knockout or knockdown strains to assess transport deficiencies

  • Membrane vesicle preparations that maintain physiological orientation

Researchers can leverage H. modesticaldum's ability to incorporate 13C-labeled substrates, as demonstrated in studies using [U-13C6]glucose and [3-13C]pyruvate for tracking carbon flow into bacteriochlorophyll g and 81-OH-Chl aF . Similar isotope labeling approaches could be adapted to track potential EcfT substrates, particularly if they contribute to biosynthetic pathways for photosynthetic pigments or other cellular components.

For experimental controls, consider that H. modesticaldum can grow on yeast extract alone , providing a baseline condition against which to compare growth and transport in defined media supplemented with specific substrates.

How might structural studies of EcfT contribute to understanding the evolution of ECF transporters in phototrophic bacteria?

Structural studies of H. modesticaldum EcfT would provide valuable insights into the evolution of ECF transporters in phototrophic bacteria. Heliobacteria are the only phototrophic representatives of the bacterial phylum Firmicutes and employ unique photosynthetic machinery . Structural characterization approaches should include:

  • X-ray crystallography or cryo-electron microscopy of purified EcfT, preferably in complex with other ECF components

  • Structural comparisons with ECF transporters from other bacterial phyla

  • Phylogenetic analysis incorporating structural information

These studies should consider that H. modesticaldum shows genomic streamlining compared to other low-G+C gram-positive bacteria . This genomic reduction might be reflected in specialized structural features of its transporters, potentially revealing evolutionary adaptations that optimize function with minimal genetic resources.

What potential applications might emerge from understanding EcfT structure and function in biotechnology and synthetic biology?

Understanding the structure and function of H. modesticaldum EcfT could enable several biotechnological applications:

  • Engineering enhanced micronutrient uptake in industrial microorganisms

  • Developing biosensors for specific vitamins or micronutrients

  • Creating synthetic transport systems for novel substrates

These applications would build on insights from H. modesticaldum's specialized metabolism. The organism utilizes the Embden-Meyerhof-Parnas (EMP) pathway for carbohydrate metabolism but lacks complete pathways for autotrophic carbon fixation . Understanding how EcfT complements these metabolic constraints could inform rational design of transport systems that enhance metabolic capabilities in synthetic organisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.