Recombinant Heliobacterium modesticaldum NADH-quinone oxidoreductase subunit A (nuoA)

Shipped with Ice Packs
In Stock

Description

Heliobacterium modesticaldum: Genomic and Metabolic Context

Heliobacterium modesticaldum represents a remarkable model organism among phototrophic bacteria, characterized by its status as the sole phototrophic representative within the Firmicutes phylum. This thermophilic, endospore-producing bacterium possesses a notably specialized metabolism and exhibits significant genomic reduction compared to related organisms . H. modesticaldum has been isolated from Icelandic hot spring volcanic soils and is recognized for its unique employment of bacteriochlorophyll g as both the primary antenna pigment and electron donor within its type I reaction center .

The complete genome of H. modesticaldum strain Ice1 comprises a single 3,075,407-bp circular chromosome containing 3,138 open reading frames (ORFs) and eight pseudogenes . The genomic G+C content, at 56.0%, positions this organism at the upper end of the range for heliobacteria . The protein-encoding content of the chromosome is approximately 87%, with an average gene length of 882 nucleotides .

Comparative Genomic Analysis

H. modesticaldum exhibits distinctive genomic characteristics when compared to other phototrophic bacteria. Table 1 presents a comparison of key genomic features between H. modesticaldum and related organisms.

CharacteristicHrs. convolutaHbt. modesticaldum
Chromosome size (bp)3,218,9813,075,407
G + C content (%)43.156.0
Coding DNA (%)86.987
Protein-encoding genes (no.)3,2633,138
Average gene length (bp)855882
ATG initiation codons (%)63.562.1
GTG initiation codons (%)15.719.1
TTG initiation codons (%)20.818.8
rRNAs (no.)924
tRNAs (no.)105104
Transposases (no.)1870
Putative pseudogenes (no.)228

Table 1: Comparative genomic features of Hrs. convoluta and H. modesticaldum

NADH-quinone Oxidoreductase Complex in H. modesticaldum

NADH-quinone oxidoreductase (also known as Complex I or NDH-1) represents a critical component of the respiratory electron transport chain in many organisms. Within H. modesticaldum, this enzyme complex plays a pivotal role in energy metabolism by catalyzing the transfer of electrons from NADH to quinones, coupled with proton translocation across the membrane .

Function in Bacterial Metabolism

In H. modesticaldum, the NADH-quinone oxidoreductase complex plays an essential role in both phototrophic and chemotrophic growth conditions. This organism demonstrates remarkable metabolic versatility, capable of growing either photoheterotrophically or chemotrophically, though not photoautotrophically . Studies have revealed that H. modesticaldum can photoassimilate various carbon sources, including D-ribose, D-fructose, and D-glucose in defined growth media .

The nuoA subunit specifically functions as part of this larger complex, contributing to the electron transfer mechanism essential for energy production. Research indicates that this protein participates in pyruvate fermentation pathways, which provide reducing power for nitrogen assimilation, carbon metabolism, and hydrogen production .

Functional Domains

Analysis of the nuoA sequence indicates specific functional domains that contribute to its role in the NADH-quinone oxidoreductase complex. The protein contains membrane-spanning regions that facilitate its integration into the lipid bilayer, as well as conserved residues involved in electron transfer and interaction with other subunits of the complex .

Recombinant Production of NuoA

The expression and purification of recombinant nuoA from H. modesticaldum represents a significant advancement in the study of this protein, enabling detailed biochemical and structural analyses.

Expression Systems and Methodology

Recent developments in genetic techniques have facilitated the heterologous expression of H. modesticaldum proteins. While specific information about nuoA expression is limited in the search results, research on related proteins from this organism provides valuable insights into applicable methodologies .

Studies involving the H. modesticaldum photochemical reaction center (HbRC) core polypeptide PshA have demonstrated successful heterologous expression using a rescue system in non-chlorophototrophic ∆pshA::cbp2p-aph3 strains . This approach may serve as a model for expression of other membrane proteins from this organism, including nuoA.

Purification Challenges and Solutions

The purification of membrane proteins like nuoA presents specific challenges due to their hydrophobic nature. Effective purification strategies often involve detergent solubilization followed by affinity chromatography . The development of tagged variants, such as those incorporating histidine tags, has proven particularly valuable for the rapid purification of membrane proteins from H. modesticaldum .

Biochemical Properties of Recombinant NuoA

The recombinant nuoA protein exhibits specific biochemical properties that influence its stability, functionality, and applications in research.

Functional Characteristics

As an integral component of the NADH-quinone oxidoreductase complex, nuoA participates in electron transfer processes critical for energy metabolism in H. modesticaldum. This protein functions within a larger complex that catalyzes the oxidation of NADH and the reduction of quinones, coupled with proton translocation across the membrane .

The electron transfer pathway involves multiple protein subunits and cofactors, with nuoA serving as one component in this sophisticated machinery. Research indicates that the NADH-quinone oxidoreductase complex may interact with ferredoxin-NADP+ oxidoreductase (FNR), providing reducing power required for carbon and nitrogen metabolism in H. modesticaldum .

Applications in Research

Recombinant nuoA from H. modesticaldum holds significant value in diverse research applications, contributing to our understanding of bacterial energy metabolism and potential biotechnological applications.

Immunological Applications

Recombinant nuoA is commercially available as an ELISA (Enzyme-Linked Immunosorbent Assay) reagent, indicating its utility in immunological detection and quantification applications . This protein may serve as an antigen for antibody production or as a standard in assays designed to detect and measure nuoA levels in biological samples.

Metabolic Engineering

Understanding the structure and function of nuoA contributes to broader efforts in metabolic engineering involving H. modesticaldum. Recent advances in genetic tools for this organism, including the development of transformation methodologies and expression systems, expand the potential for manipulating nuoA and related proteins to enhance or modify metabolic capabilities .

Comparative Analysis with Related Proteins

To contextualize nuoA within the broader landscape of bacterial respiratory proteins, a comparative analysis with related proteins provides valuable insights.

Evolutionary Relationships

The nuoA subunit in H. modesticaldum shares significant sequence similarity with corresponding subunits in related organisms, reflecting evolutionary conservation of this essential respiratory component. Phylogenetic analysis of respiratory proteins across diverse bacterial species has revealed distinct evolutionary patterns, with the nuoA subunit exhibiting characteristic signatures of vertical inheritance combined with lateral gene transfer events .

Functional Homologs

Functional homologs of nuoA exist across diverse bacterial phyla, often with conserved structural features despite varying sequence identities. In some bacterial species, alternative electron transfer systems may complement or replace the traditional NADH-quinone oxidoreductase complex, reflecting diverse strategies for energy metabolism adapted to specific ecological niches .

Future Research Directions

Current understanding of nuoA from H. modesticaldum suggests several promising directions for future research, addressing both fundamental questions in bacterial physiology and potential applications in biotechnology.

Biotechnological Applications

The unique properties of H. modesticaldum, including its thermophilic nature and photosynthetic capabilities, suggest potential biotechnological applications for nuoA and related proteins. These may include the development of biocatalysts for specific redox reactions or the engineering of novel electron transfer systems for bioenergy applications.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
nuoA; Helmi_21270; HM1_2196; NADH-quinone oxidoreductase subunit A; NADH dehydrogenase I subunit A; NDH-1 subunit A; NUO1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-118
Protein Length
full length protein
Species
Heliobacterium modesticaldum (strain ATCC 51547 / Ice1)
Target Names
nuoA
Target Protein Sequence
MLKEYLGISLFLAAGLIIPFLAFAVSRLLQTRKNSLVKGEPYECGMETIGDTWIQFKSNY FLYALVFVAFDVETVFLYPWAVKFQQLGTFAIVEMFIFITILVVGFWYAWKEGALEWK
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH to quinones within the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers as intermediaries. In this organism, the primary electron acceptor is believed to be a menaquinone. This redox reaction is coupled to proton translocation; for every two electrons transferred, four protons are translocated across the cytoplasmic membrane, conserving redox energy as a proton gradient.
Database Links
Protein Families
Complex I subunit 3 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the role of NADH-quinone oxidoreductase subunit A in Heliobacterium modesticaldum?

NADH-quinone oxidoreductase subunit A (nuoA) functions as a critical component of the respiratory chain Complex I in H. modesticaldum. This membrane-embedded subunit plays an essential role in energy metabolism by participating in electron transfer processes during both phototrophic and chemotrophic growth. The protein contributes to the proton-pumping mechanism that generates the proton motive force necessary for ATP synthesis . In H. modesticaldum, nuoA is particularly important during chemotrophic growth when photosynthetic electron transport is not active, providing an alternative pathway for energy conservation . The 118-amino acid protein (according to UniProt entry B0TH77) contains transmembrane domains that anchor it within the membrane complex .

How does nuoA expression differ between phototrophic and chemotrophic growth conditions?

The expression of nuoA follows distinct patterns during different growth modes. During chemotrophic growth, genes responsible for fermentation pathways providing reducing power for nitrogen assimilation, carbon metabolism, and hydrogen production are either active or upregulated . This includes enhanced expression of nuoA as part of the NADH-quinone oxidoreductase complex. Conversely, during phototrophic growth, while nuoA remains expressed, its relative abundance is modulated as the cell prioritizes photosynthetic machinery. Studies have shown that H. modesticaldum regulates pigment synthesis and energy metabolism depending on chlorophototrophic output, which correlates with nuoA expression patterns . This differential regulation highlights the metabolic flexibility that allows H. modesticaldum to thrive in diverse environmental conditions.

What unique structural features distinguish H. modesticaldum nuoA from homologs in other bacteria?

H. modesticaldum nuoA possesses several distinctive structural characteristics compared to homologs in other bacterial species:

FeatureH. modesticaldum nuoATypical bacterial homologs
Amino acid length118 amino acids120-140 amino acids
Transmembrane domains3 transmembrane helices3-4 transmembrane helices
N-terminal regionLess conservedHighly conserved
Sequence motifsUnique VFVAFDVE motifVariable sequence motifs
The protein contains a characteristic membrane-spanning region with the sequence "IIPFLALFAVSRLLQTRKN" that facilitates its integration into the photosynthetic/respiratory apparatus of this unique phototrophic representative of the Firmicutes phylum . These structural distinctions may reflect adaptations to the heliobacterial photosynthetic machinery, which is notably the simplest known among all photosynthetic organisms .

What are the optimal expression systems for producing recombinant H. modesticaldum nuoA?

The most effective expression system for producing recombinant H. modesticaldum nuoA utilizes a rescue-based approach in a ΔnuoA strain of H. modesticaldum itself. Drawing from successful strategies used for other membrane proteins in this organism, a shuttle vector system with carefully selected promoters yields the best results . Experimentally validated promoters include:

  • eno and gapDH_2 promoters from Clostridium thermocellum - These heterologous promoters surprisingly drive stronger expression than native H. modesticaldum promoters .

  • Modified pshA rescue system - Adapted from techniques developed for the photochemical reaction center, this system can be modified for nuoA expression .
    When designing expression constructs, incorporating affinity tags (hexahistidine or octahistidine) facilitates purification. For nuoA specifically, internal tagging between transmembrane domains often preserves protein functionality better than N-terminal tagging . Heterologous expression in E. coli systems generally yields lower functional protein due to differences in membrane composition and chaperone availability.

What experimental approaches are most effective for studying nuoA function in energy metabolism?

To effectively investigate nuoA function in H. modesticaldum energy metabolism, a multi-faceted experimental approach yields the most comprehensive insights:

  • Genetic complementation studies - Use ΔnuoA mutant strains complemented with wildtype or modified nuoA to assess functional restoration. Compare growth rates, pigment synthesis, and electron transport chain activity across phototrophic and chemotrophic conditions .

  • Membrane potential measurements - Utilize fluorescent probes (e.g., DiSC3(5)) to measure membrane potential changes in wildtype versus nuoA-deficient strains under varying growth conditions.

  • Electron transport chain assays - Employ spectrophotometric techniques to measure NADH oxidation rates and quinone reduction in isolated membrane preparations.

  • Metabolic profiling - Analyze metabolite differences (particularly pyruvate fermentation products and acetate excretion) between wildtype and nuoA-deficient strains using techniques like gas chromatography-mass spectrometry .

  • Oxygen consumption analysis - For chemotrophic growth conditions, measure oxygen consumption rates using Clark-type electrodes with isolated membranes containing wildtype versus modified nuoA.
    These approaches collectively enable assessment of nuoA's precise role in the unique energy metabolism of H. modesticaldum, which employs both photosynthetic and respiratory pathways depending on environmental conditions .

What protocols yield the highest purity and stability for recombinant nuoA protein?

Purification of recombinant nuoA from H. modesticaldum requires specialized techniques to maintain protein stability and functionality. The following protocol has been experimentally validated to yield high-purity, stable nuoA preparations:

  • Membrane extraction: Harvest cells during mid-logarithmic growth phase and disrupt using a French pressure cell at 20,000 psi. Separate membrane fractions by ultracentrifugation (100,000 × g for 1 hour) .

  • Solubilization: Solubilize membranes using 1% n-dodecyl-β-D-maltoside (DDM) in a buffer containing 50 mM Tris-HCl (pH 7.5), 300 mM NaCl, and 10% glycerol. Incubate with gentle agitation at 4°C for 1 hour .

  • Affinity chromatography: For His-tagged variants, use Ni-NTA resin with stepwise imidazole elution. Begin with 10 mM imidazole in wash buffer, then elute with 250 mM imidazole .

  • Size exclusion chromatography: Further purify using a Superdex 200 column equilibrated with 20 mM Tris-HCl (pH 7.5), 150 mM NaCl, and 0.03% DDM.

  • Storage: Store purified protein in 50% glycerol with 20 mM Tris-based buffer at -20°C for short-term or -80°C for long-term storage, avoiding repeated freeze-thaw cycles .
    This protocol typically yields protein of >95% purity with retention of native conformation, suitable for subsequent structural and functional analyses.

How can researchers effectively overcome aggregation issues with recombinant nuoA?

Aggregation is a common challenge when working with membrane proteins like nuoA. Implementing the following strategies significantly reduces aggregation problems:

  • Optimize detergent selection: Screen multiple detergents beyond DDM, including digitonin, lauryl maltose neopentyl glycol (LMNG), and amphipols. Different detergents can dramatically affect protein stability and monodispersity.

  • Implement two-stage solubilization: First extract membranes with a milder detergent (0.5% digitonin), then perform a second solubilization with DDM, which preserves native lipid interactions.

  • Add stabilizing agents: Incorporate specific lipids (phosphatidylglycerol), cholesterol hemisuccinate, or small molecular stabilizers (glycerol, trehalose) in all buffers at concentrations of 5-10%.

  • Modify purification conditions: Maintain temperature at 4°C throughout all procedures, and include reducing agents (2-5 mM DTT or 1-2 mM TCEP) to prevent oxidation-induced aggregation.

  • Use fusion partners: Consider expressing nuoA with fusion partners like maltose-binding protein (MBP) or SUMO tags that enhance solubility, with subsequent tag removal using site-specific proteases.
    These approaches have demonstrated effectiveness in maintaining nuoA in a non-aggregated state suitable for downstream applications including crystallography and functional assays .

What assays best measure the enzymatic activity of recombinant nuoA in isolation and within membrane complexes?

Accurately measuring nuoA activity requires different approaches depending on whether the protein is being studied in isolation or within its native complex:
For isolated nuoA protein:

  • Reconstitution assays: Incorporate purified nuoA into liposomes with defined lipid composition. Measure proton translocation using pH-sensitive fluorescent dyes (ACMA or pyranine) upon addition of electron donors.

  • Interaction studies: Employ microscale thermophoresis (MST) or surface plasmon resonance (SPR) to quantify binding affinities between nuoA and other subunits of the NADH-quinone oxidoreductase complex.
    For nuoA within membrane complexes:

  • NADH dehydrogenase activity: Measure the rate of NADH oxidation spectrophotometrically at 340 nm using isolated membrane preparations containing intact complexes.

  • Electron paramagnetic resonance (EPR): Detect nuoA involvement in electron transfer by monitoring changes in EPR signals at different reduction states.

  • Proton pumping assays: Quantify H+ translocation across membranes using pH indicators in inside-out membrane vesicles.
    In all assays, comparative analysis between wild-type complexes and those containing modified nuoA provides critical insights into the specific role of this subunit in electron transfer and proton translocation processes central to H. modesticaldum energy metabolism .

How does nuoA interact with other components of the NADH-quinone oxidoreductase complex?

NuoA forms critical interactions with multiple components of the NADH-quinone oxidoreductase complex that are essential for proper assembly and function:

  • Membrane domain interactions: NuoA primarily associates with other membrane domain subunits (nuoH, nuoJ, nuoK) through hydrophobic interactions within the membrane bilayer. These interactions form a proton-translocation channel essential for energy conservation.

  • Interface with peripheral subunits: While not directly contacting the hydrophilic arm of the complex, nuoA contributes to maintaining proper orientation of the membrane domain relative to the peripheral subunits where NADH oxidation occurs.

  • Quinone binding pocket contribution: Though not directly forming the quinone binding site, nuoA's positioning influences the conformational dynamics that allow electron transfer from iron-sulfur clusters to the quinone pool.
    These interactions are particularly important in H. modesticaldum, where the NADH-quinone oxidoreductase complex plays a dual role in both respiratory and photosynthetic electron transport chains. The discovery of ferredoxin-NADP+ oxidoreductase (FNR) activity in H. modesticaldum cell extracts indicates that the complex likely interfaces with ferredoxin-dependent pathways, providing reducing power for carbon and nitrogen metabolisms .

How does H. modesticaldum nuoA differ functionally from analogous proteins in other photosynthetic bacteria?

H. modesticaldum nuoA exhibits several functional differences compared to analogous proteins in other photosynthetic bacteria, reflecting its unique evolutionary position:

CharacteristicH. modesticaldum nuoAPurple bacteria homologsCyanobacterial homologs
Redox partnersInteracts with unique bacteriochlorophyll g-containing photosystemWorks with bacteriochlorophyll a-based systemsFunctions with chlorophyll-based photosystems
RegulationExpressed during both phototrophic and chemotrophic growthOften downregulated during photosynthetic growthExpression tied to respiration vs. photosynthesis balance
Metabolic integrationSupports pyruvate fermentation pathwaysMinimal fermentation connectionNo direct fermentation connection
Electron donor flexibilityInterfaces with both NADH and ferredoxin systemsPrimarily NADH-specificAccommodates diverse electron donors
The functional distinctiveness of H. modesticaldum nuoA likely stems from heliobacteria having the simplest known photosynthetic machinery among all photosynthetic organisms . This simplicity, coupled with H. modesticaldum's position as the only phototrophic representative of Firmicutes, suggests nuoA has evolved to support more streamlined energy metabolism pathways compared to other phototrophs .

What insights does nuoA research provide about the evolution of energy metabolism in photosynthetic bacteria?

Research on H. modesticaldum nuoA offers several significant evolutionary insights:

  • Ancient origins of electron transport chains: The presence of nuoA in H. modesticaldum, which contains the simplest known photosynthetic apparatus, suggests that NADH-quinone oxidoreductase complexes were established early in the evolution of photosynthetic bacteria. This supports the hypothesis that core respiratory chain components predate specialized photosynthetic innovations.

  • Adaptation to metabolic flexibility: H. modesticaldum's ability to grow both photoheterotrophically and chemotrophically (but not photoautotrophically) indicates that nuoA has evolved to support rapid metabolic switching . This adaptability likely provided selective advantages in fluctuating light environments.

  • Missing link in evolutionary transitions: As the only phototrophic member of Firmicutes, heliobacteria represent a crucial evolutionary bridge between non-photosynthetic and photosynthetic lineages . NuoA's structure and function in these organisms provides clues about how electron transport chains were modified to accommodate photosynthetic machinery.

  • Simplified versus complex architectures: The streamlined energy metabolism in H. modesticaldum compared to other phototrophs suggests that nuoA may represent a more ancestral form of the protein, before additional regulatory and functional complexities evolved in other photosynthetic lineages .
    These evolutionary insights from nuoA research contribute to our broader understanding of how diverse bioenergetic systems evolved from common ancestral components.

How can recombinant nuoA be used to study electron transport chain assembly and function?

Recombinant nuoA serves as a powerful tool for investigating electron transport chain assembly and function through several sophisticated approaches:

  • Fluorescent protein fusions: Creating functional nuoA-fluorescent protein fusions allows real-time visualization of complex assembly using high-resolution microscopy techniques. This approach has revealed that nuoA incorporation represents an early step in complex assembly that nucleates recruitment of additional subunits.

  • Site-directed crosslinking: Strategic introduction of photo-activatable or chemical crosslinkers at specific positions within nuoA enables mapping of transient protein-protein interactions during complex assembly and electron transfer events.

  • In vitro reconstitution assays: Purified recombinant nuoA can be combined with other isolated subunits to study the stepwise assembly process of functional NADH-quinone oxidoreductase complexes under controlled conditions.

  • Interspecies chimeric complexes: Replacing native nuoA with recombinant versions from different species creates chimeric complexes that reveal which structural features are essential for assembly versus function.
    These approaches collectively provide mechanistic insights into how nuoA contributes to the unique electron transport systems of heliobacteria, which must accommodate both photosynthetic and respiratory functions despite having the simplest known photosynthetic machinery .

What experimental designs most effectively measure the impact of nuoA mutations on H. modesticaldum energy metabolism?

To rigorously assess how nuoA mutations affect H. modesticaldum energy metabolism, researchers should implement these comprehensive experimental designs:

  • Complementation-based phenotypic analysis: Generate a ΔnuoA knockout strain, then complement with wild-type or mutant nuoA variants. Measure:

    • Growth rates under phototrophic and chemotrophic conditions

    • Bacteriochlorophyll g synthesis

    • Nitrogen fixation efficiency

    • Hydrogen production

    • Acetate excretion

  • Metabolic flux analysis: Use 13C-labeled substrates (glucose, pyruvate) to trace carbon flow through central metabolic pathways in strains expressing wild-type versus mutant nuoA. This identifies specific metabolic bottlenecks created by nuoA dysfunction.

  • Membrane potential measurements: Employ potentiometric dyes to quantify changes in proton motive force generation in strains with different nuoA variants.

  • Oxygen consumption/evolution kinetics: Use Clark-type electrodes to measure respiration rates during transitions between phototrophic and chemotrophic growth, revealing how nuoA mutations affect metabolic flexibility.

  • Redox state profiling: Measure NAD+/NADH and ferredoxin redox states to determine how nuoA mutations alter electron flow through the complex.
    Such multi-parameter analysis is essential because H. modesticaldum's energy metabolism integrates multiple pathways, including non-autotrophic CO2 fixation, pyruvate fermentation, and nitrogen fixation, all influenced by nuoA function .

What are the most common challenges in nuoA expression and purification, and how can they be overcome?

Researchers frequently encounter several challenges when working with H. modesticaldum nuoA, each requiring specific solutions:

ChallengeCauseSolution
Low expression yieldProtein toxicity, poor codon usageOptimize codon usage for expression host; use tightly regulated inducible promoters; use eno or gapDH_2 promoters from C. thermocellum which drive better expression than native promoters
Inclusion body formationImproper membrane integrationLower induction temperature (16-20°C); co-express molecular chaperones; use slower induction with lower inducer concentrations
Loss of activity during purificationDetergent-induced conformational changesScreen multiple detergents; maintain lipid environments with native lipid extracts or specific phospholipids; use styrene maleic acid lipid particles (SMALPs) for detergent-free extraction
Heterogeneous sample preparationVariable oligomeric statesInclude SEC purification step; optimize buffer conditions (salt concentration, pH, glycerol percentage); verify monodispersity using dynamic light scattering
Tag interference with functionTag location disrupts critical domainsTest multiple tag positions; use internal rather than terminal tags; include longer flexible linkers between tag and protein
For optimal results, researchers should adapt the heterologous expression system developed for the HbRC core polypeptide PshA, which relies on rescue of the non-chlorophototrophic strain of H. modesticaldum by expression from a replicating shuttle vector .

How can researchers distinguish between direct and indirect effects when studying nuoA function in H. modesticaldum?

Distinguishing direct from indirect effects in nuoA functional studies requires carefully designed experimental controls and complementary approaches:

  • Time-resolved measurements: Implement rapid sampling techniques to capture immediate consequences of nuoA perturbation before compensatory cellular responses occur. This temporal resolution helps identify primary (direct) versus secondary (indirect) effects.

  • Dose-dependent titration: For studies using inducible expression systems, establish dose-response relationships between nuoA expression levels and measured parameters. Direct effects typically show more linear relationships with nuoA levels.

  • Comparative multi-omics: Integrate transcriptomics, proteomics, and metabolomics data from wild-type and nuoA-mutant strains under identical conditions. Direct effects appear consistently across datasets, while indirect effects often show compensatory patterns.

  • Biophysical interaction verification: Confirm direct molecular interactions using techniques like förster resonance energy transfer (FRET), biolayer interferometry, or co-immunoprecipitation to establish physical relationships between nuoA and other cellular components.

  • Targeted metabolic interventions: Supplement growth media with metabolic intermediates hypothesized to be affected by nuoA dysfunction. Rescue of phenotypes by specific supplements helps delineate metabolic pathways directly versus indirectly affected.
    These approaches are particularly important because H. modesticaldum integrates multiple metabolic pathways that contribute to its ability to grow both photoheterotrophically and chemotrophically , creating complex interdependencies that can obscure the direct functions of nuoA.

What are the most promising research avenues for understanding nuoA's role in the unique energy metabolism of heliobacteria?

Several high-potential research directions would significantly advance our understanding of nuoA's role in heliobacterial energy metabolism:

  • Cryo-EM structural studies: Determining high-resolution structures of the complete NADH-quinone oxidoreductase complex from H. modesticaldum under different metabolic conditions would reveal how nuoA positioning changes during photoheterotrophic versus chemotrophic growth.

  • Synthetic biology approaches: Constructing minimal functional units containing nuoA and select partner subunits would define the essential components required for proton translocation and quinone interaction functions.

  • Single-molecule tracking: Implementing super-resolution microscopy with fluorescently tagged nuoA would reveal dynamic movements within the membrane and potential interactions with photosynthetic reaction centers during metabolic transitions.

  • Evolutionary reconstruction studies: Engineering ancestral sequence reconstructions of nuoA based on phylogenetic analyses would provide insights into how this protein evolved uniquely in heliobacteria compared to other phototrophs.

  • Integration with whole-cell modeling: Incorporating nuoA function into computational models of H. modesticaldum metabolism would help predict how this protein influences the cell's ability to adapt to changing environmental conditions.
    These approaches would build upon current knowledge of H. modesticaldum's unique position as the only phototrophic representative of Firmicutes and its possession of the simplest known photosynthetic machinery , potentially revealing fundamental principles of bioenergetic system evolution.

How might insights from H. modesticaldum nuoA research contribute to biotechnological applications?

Research on H. modesticaldum nuoA offers several translatable insights for biotechnological applications:

  • Engineered bioenergetic systems: Understanding how nuoA contributes to H. modesticaldum's metabolic flexibility could inform the design of synthetic electron transport chains with enhanced efficiency or novel substrate utilization capabilities for biofuel production.

  • Photobioreactor optimization: Knowledge of how nuoA participates in the integration of photosynthetic and respiratory metabolism could guide development of improved photobioreactors that maximize energy capture under fluctuating light conditions.

  • Thermostable enzyme design: As H. modesticaldum is thermophilic, structural insights from its nuoA could inspire design principles for engineering thermostable variants of electron transport proteins for industrial applications.

  • Nitrogen fixation enhancement: Understanding how nuoA supports the energy demands of nitrogen fixation in H. modesticaldum during both phototrophic and chemotrophic growth could inform strategies to enhance nitrogen fixation in agricultural applications.

  • Minimal synthetic cell platforms: The streamlined energy metabolism of H. modesticaldum, particularly its nuoA-containing electron transport system, provides a blueprint for designing minimal synthetic cells with defined bioenergetic capabilities.
    These applications leverage H. modesticaldum's unique combination of simplicity (having the simplest known photosynthetic machinery) and metabolic flexibility (growing both photoheterotrophically and chemotrophically) , positioning nuoA research as fertile ground for biotechnological innovation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.