KEGG: vg:5076059
Heliothis virescens ascovirus 3e (HvAV-3e) is a double-stranded DNA virus belonging to the family Ascoviridae. These viruses typically infect caterpillars of several Noctuidae species through transmission by parasitoid wasps . ORF58 is an uncharacterized protein encoded by this virus with UniProt accession number A4KXB3 . The full amino acid sequence of ORF58 is known, consisting of 225 amino acids, but its specific function within the viral life cycle remains to be fully elucidated . Ascoviruses are known to cause a characteristic milky-white appearance in the hemolymph of infected lepidopteran larvae, resulting from virus-induced cellular vesicles .
For optimal stability and activity, recombinant ORF58 protein should be stored in a Tris-based buffer with 50% glycerol at -20°C for regular use, or at -80°C for extended storage . Working aliquots can be maintained at 4°C for up to one week to minimize freeze-thaw cycles, as repeated freezing and thawing significantly reduces protein integrity and activity . When planning experiments, researchers should create single-use aliquots based on experimental requirements to preserve protein quality. The storage buffer is specifically optimized for this protein, and alterations to buffer composition may affect protein stability and functionality.
ORF58 belongs to a group of uncharacterized viral proteins that are common across many dsDNA viruses. Comparative genomic analyses of ascoviruses reveal considerable variability in non-conserved ORFs across different ascovirus species and isolates . Unlike structural proteins or enzymes with clearly defined functions, uncharacterized proteins like ORF58 often display high sequence divergence even within the same virus family. Phylogenetic analyses using bipartite network construction and amino acid identity (AAI) calculations can help establish evolutionary relationships between ORF58 and similar proteins in other ascoviruses . These comparisons are particularly valuable for inferring potential functions based on structural similarities that may not be apparent at the sequence level.
Multiple complementary approaches should be employed to characterize ORF58's function. Begin with bioinformatic analyses including structural prediction tools to identify potential functional domains, followed by sequence alignment with proteins of known function . Next, generate knockout or mutant viruses lacking functional ORF58 to observe phenotypic changes during infection. Protein-protein interaction studies using co-immunoprecipitation, yeast two-hybrid systems, or proximity labeling can identify binding partners that may indicate function . Transcriptomic analyses comparing gene expression patterns between wild-type and ORF58-deficient viruses can provide insights into pathways affected by this protein . Finally, heterologous expression systems can be used to produce sufficient quantities of the protein for biochemical assays testing hypothesized functions, such as enzymatic activity, nucleic acid binding, or immune modulation capabilities.
For uncharacterized viral proteins like ORF58, employing multiple structural prediction approaches in parallel yields the most reliable results. AlphaFold2 and RoseTTAFold have demonstrated remarkable accuracy for novel protein fold prediction, though viral proteins present unique challenges due to their rapid evolution and structural divergence . When applying these tools to ORF58, researchers should be aware that approximately 62% of viral proteins lack structural homologues in current databases , necessitating additional validation approaches. Combining deep learning-based predictions with experimental techniques such as circular dichroism spectroscopy to determine secondary structure content is recommended. For more definitive structural characterization, X-ray crystallography remains the gold standard, but cryo-electron microscopy is increasingly valuable, especially for membrane-associated viral proteins. Critical assessment of predicted models should include evaluation of Z-scores from ProSA-web, Ramachandran plot analysis, and verification of predicted binding pockets using CASTp or similar tools.
Post-translational modifications (PTMs) likely play crucial roles in regulating ORF58 functionality during different stages of viral infection. While specific PTMs for ORF58 have not been experimentally confirmed, in silico prediction tools indicate potential phosphorylation sites within its sequence that may regulate protein-protein interactions or enzymatic activity . Phosphoproteomics studies of infected host cells could identify differential phosphorylation patterns of ORF58 during the viral life cycle. Other possible PTMs include ubiquitination, which may regulate protein stability and turnover; SUMOylation, which could affect protein localization and interactions; and glycosylation, which might be important if ORF58 functions at the cell surface or in extracellular vesicles. Methodologically, researchers should employ targeted mass spectrometry approaches using selected reaction monitoring (SRM) to identify and quantify specific PTMs on purified ORF58. Time-course experiments examining PTM changes throughout infection would be particularly valuable for understanding the dynamic regulation of this protein.
Structural comparison analysis suggests that ORF58 may function in viral immune evasion, particularly when compared to RNA ligase T-like phosphodiesterases that have been identified in other viral systems . These enzymes have been shown to hydrolyze host immune-activating molecules like cyclic dinucleotides (cGAMP), effectively suppressing innate immunity . To determine if ORF58 possesses similar activity, researchers should first perform detailed structural alignment with characterized phosphodiesterases and identify potential catalytic residues. Subsequent biochemical assays using purified recombinant ORF58 with potential substrates like 2'3'-cGAMP would confirm enzymatic function. Further validation could include cell-based reporter assays measuring cGAS-STING pathway activation in the presence and absence of ORF58. For comprehensive analysis, researchers should design point mutations targeting predicted catalytic residues and assess how these mutations affect both enzymatic activity in vitro and viral fitness in vivo. Single-cell RNA sequencing of infected versus uninfected cells would provide insights into how ORF58 modulates host immune transcriptional responses.
Transcriptomic analysis provides crucial insights into when and under what conditions ORF58 is expressed during infection. Time-course RNA sequencing experiments comparing infected and uninfected host cells can establish if ORF58 is an early, intermediate, or late gene in the viral replication cycle . Studies of Heliothis virescens ascovirus 3h (HvAV-3h) in Spodoptera exigua larvae demonstrated that viral infection significantly alters host gene expression patterns over time (6-168 hours post-infection), with most host transcripts downregulated beginning at 6 hours post-infection . Similar approaches should be applied to analyze ORF58 expression. Quantitative RT-PCR validation of RNA-seq findings can confirm expression patterns with higher sensitivity. Researchers should also perform differential expression analysis under various stress conditions to determine if ORF58 expression responds to specific host defense mechanisms. Additionally, ribosome profiling could reveal if ORF58 undergoes translational regulation during infection. These approaches collectively would establish both the expression timing and potential regulatory factors influencing ORF58, providing context for functional studies.
For efficient expression of recombinant ORF58, a codon-optimized synthetic gene should be designed based on the amino acid sequence (MSLTERIGQTPKAYELANERGPFSVEVYLNPGTSNTYQYVATTRNKFNNTDYDDLPWNYTSGKKVVTATGVVSGGERYVFLLRSEIAQDIQVTMYNTNGGSNPLNNSNVTRSNVDSSSYYQQPPQVVYNNGDLYGSRTGYSGAELGASIDKGIASLWGYLKQPLVMVGIAAVVGYLIYRYYYMSRPIGFGSSGAYDVPLLDTPLLRDSYRLPQSFTRDPLFRNSV) . Expression in E. coli BL21(DE3) using a pET vector system with an N-terminal His-tag allows for straightforward purification by immobilized metal affinity chromatography (IMAC). Induction should be performed at lower temperatures (16-18°C) for 16-18 hours using 0.1-0.5 mM IPTG to enhance soluble protein yield. If inclusion bodies form, consider fusion tags like SUMO or MBP to improve solubility. After initial IMAC purification, size exclusion chromatography is recommended to achieve high purity. The final buffer should contain 20-50 mM Tris-HCl (pH 7.5-8.0), 100-300 mM NaCl, 1-5 mM DTT or TCEP, and 10% glycerol. For long-term storage, increase glycerol concentration to 50% . Alternative expression systems like insect cells (using baculovirus vectors) may be necessary if post-translational modifications are critical for function or if bacterial expression yields inactive protein.
When designing knockout or mutant studies for ORF58, researchers must consider several methodological challenges. First, generate a complete deletion mutant using homologous recombination techniques with approximately 500-1000 bp flanking regions around ORF58. Confirm the deletion by PCR and sequencing to ensure no partial ORF58 sequences remain. For complementation studies, construct rescue viruses containing wild-type ORF58 under its native promoter to verify that observed phenotypes are specifically due to ORF58 absence. Additionally, create point mutations targeting predicted functional domains to distinguish between structural and catalytic roles. When characterizing mutants, perform multi-parameter analysis including: (1) growth kinetics in different cell lines, (2) electron microscopy to assess virion morphology, (3) qPCR for viral genome replication efficiency, (4) Western blotting to analyze viral protein expression patterns, and (5) cell-to-cell spread assays. The most informative approach compares virus fitness in multiple host species to determine if ORF58 functions are host-specific, which may indicate roles in immune evasion or host adaptation.
A multi-layered approach is necessary to comprehensively identify ORF58 interaction partners. Begin with proximity-dependent biotin identification (BioID) by expressing ORF58 fused to a promiscuous biotin ligase in infected cells, followed by streptavidin pulldown and mass spectrometry to identify proximal proteins. Validate key interactions using co-immunoprecipitation with antibodies against ORF58 or epitope-tagged versions. For temporal dynamics of these interactions, implement stable isotope labeling with amino acids in cell culture (SILAC) combined with quantitative proteomics. Confocal microscopy with fluorescently tagged ORF58 can confirm co-localization with potential partners in different cellular compartments throughout infection. For direct interaction assessment, use surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) with purified components. Functional validation of identified interactions should involve siRNA knockdown or CRISPR knockout of host interaction partners followed by analysis of viral replication efficiency. Additionally, performing cross-linking mass spectrometry (XL-MS) can map interaction interfaces at the amino acid level, guiding subsequent mutagenesis studies to disrupt specific interactions while minimizing structural perturbations.
Sequence variation analysis of ORF58 across different Heliothis virescens ascovirus isolates provides insights into evolutionary constraints and potential functional domains. Comparative genomic studies of ascovirus genomes indicate that significant differences exist between variants, particularly in homologous repeat (hr) regions and bro genes . To analyze ORF58 specifically, researchers should collect sequences from multiple geographical isolates and perform multiple sequence alignment followed by calculation of nucleotide and amino acid substitution rates. Calculating the ratio of non-synonymous to synonymous substitutions (dN/dS) across the ORF58 coding sequence can identify regions under purifying selection (conserved, functionally important domains) versus regions under positive selection (potentially involved in host adaptation). Sliding window analysis of sequence conservation can pinpoint specific motifs that may be critical for function. Comparison with ORF58 homologs in related ascoviruses provides evolutionary context, while phylogenetic analysis using maximum likelihood methods can reconstruct the evolutionary history of this protein. These analyses collectively inform hypothesis generation about protein function and guide experimental design for functional validation.
Structural comparison approaches reveal potential functional similarities between ORF58 and proteins from diverse viral families despite low sequence homology. Utilizing the growing database of viral protein structures , researchers should employ fold recognition tools like HHpred or DALI to identify potential structural analogues of ORF58. Although 62% of viral proteins lack structural homologues in databases like AlphaFold , the remaining 38% can provide valuable functional insights through structural alignment. Particular attention should be given to comparisons with proteins from Poxviridae, as they share some evolutionary relationships with Asfarviridae . If structural analysis suggests enzymatic function, active site comparisons focusing on spatial arrangement of catalytic residues rather than primary sequence can be particularly informative. Additionally, researchers should examine potential structural homology to immune evasion proteins like viral phosphodiesterases that hydrolyze immune-activating cyclic dinucleotides . Experimental validation of predicted functions should include biochemical assays tailored to test specific activities suggested by structural similarities, coupled with mutagenesis of putative functional residues identified through structural alignment.
Functional characterization of uncharacterized viral proteins like ORF58 presents several technical challenges. First, the absence of predicted functional domains complicates hypothesis generation. Researchers should implement unbiased functional screening approaches, including phenotypic assays in various cell types following ORF58 expression, and high-throughput biochemical activity screens testing multiple substrate classes. Protein solubility issues during recombinant expression frequently occur with viral proteins; address these by systematically testing various expression conditions, fusion tags, and buffer compositions. For proteins with potential membrane association, consider nanodiscs or liposome reconstitution systems to maintain native conformation. When generating antibodies against ORF58, design multiple epitopes across the protein sequence to increase success probability, and validate antibody specificity using knockout controls. Temporal expression analysis may be challenging if ORF58 is expressed at low levels; employ highly sensitive techniques like digital droplet PCR or single-molecule FISH. Finally, functional redundancy within viral genomes may mask phenotypes in single-gene knockout studies; consider combinatorial knockouts of related genes if initial experiments yield negative results. Throughout the troubleshooting process, maintain detailed records of conditions tested to identify patterns that might provide functional insights.
Distinguishing between host and viral interaction partners requires methodical experimental approaches. Implement affinity purification-mass spectrometry (AP-MS) of tagged ORF58 expressed in both uninfected cells and cells infected with ORF58-deleted virus to differentiate virus-dependent and virus-independent interactions. Quantitative comparison can reveal interactions that occur only in the presence of other viral factors. For temporal resolution, perform time-course AP-MS experiments at different stages of infection. Cross-validation using reciprocal co-immunoprecipitation with antibodies against candidate interactors strengthens confidence in identified interactions. When analyzing mass spectrometry data, implement stringent statistical filtering using tools like SAINT (Significance Analysis of INTeractome) to distinguish true interactors from background contaminants. For spatial context, perform immunofluorescence microscopy to track ORF58 localization throughout infection, noting co-localization with cellular compartments or structures. Split-protein complementation assays such as bimolecular fluorescence complementation (BiFC) provide direct visual evidence of protein-protein interactions in living cells. Finally, functional validation through siRNA-mediated depletion of putative host factors can confirm their importance for ORF58 function during viral replication.