Recombinant Heliothis zea nuclear polyhedrosis virus Occlusion-derived virus envelope protein E56 (odv-e56)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Heliothis zea nuclear polyhedrosis virus Occlusion-derived virus envelope protein E56 (ODV-E56) is a protein component found in the Heliothis zea single nucleocapsid nuclear polyhedrosis virus (HzSNPV) . Baculoviruses like HzSNPV play a key role in regulating insect populations in the ecosystem and have been explored as targeted biopesticides for many years . ODV-E56 is a viral envelope protein that is expressed by a recombinant virus .

General Information and Characteristics

ODV-E56 is a protein that is expressed in E. coli as a full-length protein (amino acids 1-175) with an N-terminal His tag . The protein's amino acid sequence is: ALRRTGGSYYHIGLNGGEQVESCLLRYRTCVLDVNNLNDVNVCPSDPLIDNINALQSVCHGYNAEVERTVCRRSDPNADPLSLQYVDISPLATGHTISCIEPYDFGDLIGDLGLDGEGLLNKSSDKSSTSFQKLLPIIVVLGIVLLIIFIGYIVIKRMLMQPPPPPANYNR .

Synonyms: odv-e56, Occlusion-derived virus envelope protein E56, ODV-E56, ODVP-6E, Fragment
UniProt ID: O10620
Source: E. coli
Tag: His
Protein Length: Full Length (1-175aa)
Form: Lyophilized powder
Purity: Greater than 90% as determined by SDS-PAGE
Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles .
Storage Buffer: Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution: Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃ .

Role in Baculovirus Infection

Baculoviruses have two distinct virion phenotypes during their replication cycle: budded virus (BV) and occlusion-derived virus (ODV) . ODV is involved in the initial infection of insect larvae following the ingestion of occlusion bodies called polyhedra . The polyhedra dissolve in the insect midgut, releasing ODV particles that then infect midgut cells . ODV-E56 is a component of the ODV envelope, which is crucial for the virus's infectivity . Certain viral proteins associated with ODV, such as ODV-E66, P74, PIF1, PIF2, PIF3, and PIF5, have been found encapsulated in the polyhedra matrix .

Research and Applications

  • Protein Interaction and Function: Proteomics analyses have identified ODV-E56 as an ODV-associated protein . Research is ongoing to determine the specific functions of ODV-E56 and other ODV proteins in the baculovirus infection cycle .

  • Potential as a Carrier: Studies suggest that the polyhedra of baculoviruses have the capacity to trap foreign proteins, making them potential carriers for incorporating proteins of interest. For example, the immobilization of enhanced green fluorescent protein (eGFP) into the polyhedra has been demonstrated, suggesting that proteins like ODV-E56 could be utilized for similar purposes .

  • Biopesticide Development: Baculoviruses, including HzSNPV, are used as biopesticides due to their host specificity and safety to non-target organisms . Understanding the function of proteins like ODV-E56 can contribute to the development of more effective viral insecticides.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for customers.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
odv-e56; Occlusion-derived virus envelope protein E56; ODV-E56; ODVP-6E; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-175
Protein Length
full length protein
Species
Heliothis zea nuclear polyhedrosis virus (HzSNPV) (Helicoverpa zea single nucleocapsid nuclear polyhedrosis virus)
Target Names
odv-e56
Target Protein Sequence
ALRRTGGSYYHIGLNGGEQVESCLLRYRTCVLDVNNLNDVNVCPSDPLIDNINALQSVCH GYNAEVERTVCRRSDPNADPLSLQYVDISPLATGHTISCIEPYDFGDLIGDLGLDGLLGE EGLLNKSSDKSSTSFQKLLPIIVVLGIVLLIIFIGYIVIKRMLMQPPPPPANYNR
Uniprot No.

Target Background

Function

Structural protein specific to occlusion-derived virus (ODV) envelopes, but not budded virus (BV) envelopes.

Protein Families
Baculoviridae E56 family
Subcellular Location
Virion membrane; Multi-pass membrane protein. Note=Localized to the envelope region of preoccluded bundles of virions.

Q&A

What is ODV-E56 and what is its role in baculovirus biology?

ODV-E56 is an occlusion-derived virus (ODV)-specific envelope protein found in baculoviruses. It is a crucial component for oral infectivity in lepidopteran hosts. The protein is encoded by the odv-e56 gene, which has been identified in multiple baculovirus species. In Autographa californica multiple nucleopolyhedrovirus (AcMNPV), studies have shown that ODV-E56 plays a critical role in the initial infection process in the insect midgut, as recombinant viruses lacking functional ODV-E56 showed profoundly impaired oral infectivity while maintaining normal budded virus production in cell culture .

ODV-E56 functions as part of the per os infectivity factors (PIFs) but notably operates independently from the PIF complex that contains other infectivity factors (P74, PIF1, PIF2, PIF3, PIF4, and P95). This independent operation suggests that ODV-E56 may be involved in a separate pathway or mechanism during the infection process .

How is ODV-E56 identified in baculovirus proteomes?

ODV-E56 has been identified through various proteomic approaches, including:

  • Library screening

  • SDS-PAGE with mass spectrometry

  • MUDPIT-MS/MS analysis

  • Western blotting with specific antibodies

In a comprehensive study of AcMNPV ODV composition, ODV-E56 (corresponding to ORF148) was detected with 46.2% protein coverage using SDS-PAGE followed by mass spectrometry . The table below summarizes the detection methods used to identify ODV-E56 along with other ODV proteins:

ORFIdentityLibrary screenSDS/PAGE, % coverageMUDPIT-MS/MSWestern blotRef.
148ODV-E56346.2*18, 51

This methodological approach demonstrates the rigorous verification process used to confirm ODV-E56 as a genuine structural component of the ODV virion .

What genome characteristics are associated with the odv-e56 gene in baculoviruses?

The odv-e56 gene is conserved across baculoviruses and nudiviruses. In Helicoverpa zea nudivirus 2 (HzNV-2), the gene identified as Hz2V062 encodes a protein homologous to ODV-E56 structural protein. This gene is located on the reverse strand (indicated by "R") of the genome at positions 120105-118786, comprising 1320 nucleotides that encode a 440 amino acid protein .

The evolutionary relationship of this gene can be traced to other nudiviruses, as shown by significant similarity to the ODV-E56 protein in Gryllus bimaculatus nudivirus with an E-value of 2 × 10^-9 . This conservation across different virus species highlights the functional importance of ODV-E56 throughout the evolution of these viral families.

How can recombinant viruses be constructed to study ODV-E56 function?

Construction of recombinant viruses to study ODV-E56 function requires sophisticated molecular biology techniques. Based on published research methodologies, the following approach can be implemented:

  • Gene Deletion Strategy:

    • Use the Datsenko and Wanner method to replace the pif5 (odv-e56) gene with an antibiotic resistance marker (e.g., zeocin)

    • Design primers with homologous regions flanking the odv-e56 gene plus sequences for the resistance marker

    • Amplify the resistance cassette using PCR

    • Electroporate the PCR product into E. coli cells containing a baculovirus bacmid

    • Select colonies resistant to the appropriate antibiotics

  • Verification of Gene Deletion:

    • Confirm correct insertion using PCR with specific primer pairs

    • One primer pair should include a primer specific to the resistance gene and a primer outside the targeted region

    • Another pair should span the insertion site to confirm the absence of the wild-type gene

  • Alternative Gene Replacement Approach:

    • For studying orthologous genes, construct recombinant viruses where the native odv-e56 gene is replaced with that from another virus

    • For example, researchers replaced AcMNPV odv-e56 with Rachiplusia ou MNPV (RoMNPV) odv-e56 to study host range determination

  • Expression Tagging:

    • Add epitope tags (e.g., HA tag) to facilitate protein detection in subsequent analyses

    • Design primers that incorporate the tag sequence while maintaining the reading frame

These methodological approaches provide researchers with the tools to investigate the functional roles of ODV-E56 through targeted genetic manipulation.

What experimental evidence supports the role of ODV-E56 in oral infectivity?

Multiple lines of experimental evidence demonstrate the critical role of ODV-E56 in oral infectivity:

  • Bioassay Results with ODV-E56 Knockout Viruses:
    In a definitive study, researchers constructed recombinant AcMNPV clones (Ac69GFP-e56lacZ and AcIEGFP-e56lacZ) with disrupted ODV-E56 protein synthesis by inserting a β-galactosidase (lacZ) expression cassette into the odv-e56 open reading frame. When tested against three lepidopteran host species, these mutant viruses showed profoundly impaired oral infectivity compared to wild-type and control recombinant viruses. Importantly, the oral infectivity was fully restored through marker rescue with either AcMNPV or RoMNPV odv-e56 genes .

  • Normal BV Production in Cell Culture:
    Despite the severe defect in oral infectivity, the odv-e56 recombinant viruses exhibited no alterations in polyhedron production and morphogenesis or in the production of infectious budded virus in cell culture. This indicates that ODV-E56 plays a specific role in the oral infection pathway rather than in general virus replication or assembly .

  • Independence from the PIF Complex:
    Blue native PAGE analysis revealed that PIF5 (ODV-E56) operates separately from the PIF complex that contains other per os infectivity factors. This separation suggests a distinct function in the infection process, potentially in events downstream of binding and fusion, such as nucleocapsid transport .

These findings collectively provide strong evidence that ODV-E56 is essential for oral infectivity in baculoviruses, though its precise mechanism remains an area for further research.

How does evolutionary selection pressure affect ODV-E56, and what are the implications for host range determination?

ODV-E56 exhibits interesting evolutionary patterns that may influence viral host range:

The evolutionary patterns of ODV-E56 highlight its importance in the virus life cycle and suggest complex roles in host-virus interactions that warrant further investigation.

What are the optimal bioassay methods for evaluating ODV-E56 function in oral infectivity?

When designing bioassays to evaluate ODV-E56 function in oral infectivity, researchers should consider the following methodological approach:

  • Virus Preparation:

    • Generate multiple recombinant virus constructs including:

      • Wild-type virus (positive control)

      • ODV-E56 knockout virus

      • Marker rescue virus (restoring ODV-E56 function)

      • Control recombinant virus with unrelated gene manipulations

    • Purify occlusion bodies (OBs) from infected cell cultures

    • Quantify OBs using a hemocytometer to ensure accurate dosing

  • Host Selection:

    • Test multiple lepidopteran host species with varying susceptibility

    • Include both highly susceptible and less susceptible species to detect potential host range effects

    • Use early instar larvae for maximum sensitivity

  • Infection Protocol:

    • Use a droplet feeding method with precise OB concentrations

    • Prepare a series of viral dilutions (typically 5-7 concentrations)

    • Include a dye (e.g., blue food coloring) to visualize ingestion

    • Allow larvae to feed until visualization of dye in the gut

    • Transfer larvae to artificial diet and monitor for mortality

  • Data Collection and Analysis:

    • Record mortality daily for 7-14 days post-infection

    • Calculate median lethal concentration (LC50) values using Probit analysis

    • Compare LC50 values and their 95% confidence limits between virus constructs

    • Apply appropriate statistical tests (e.g., analysis of variance) to determine significant differences

    • Consider time-to-death analyses as an additional measure of virulence

  • Control Measures:

    • Include mock-infected controls to establish baseline mortality

    • Verify virus identity and purity through PCR or restriction enzyme analysis

    • Confirm protein expression/absence through Western blotting

This comprehensive bioassay approach provides robust data on the contribution of ODV-E56 to oral infectivity and potential host range effects.

How can protein-protein interactions involving ODV-E56 be investigated?

To investigate protein-protein interactions involving ODV-E56, researchers can employ several complementary approaches:

  • Blue Native PAGE Analysis:

    • Extract ODVs from purified occlusion bodies using an alkaline solution (e.g., DAS solution: 0.1 M Na2CO3, 166 mM NaCl, and 10 mM EDTA, pH 10.5)

    • Remove undissolved debris by centrifugation

    • Process the ODV sample with non-denaturing detergent

    • Perform blue native PAGE to maintain protein complexes intact

    • Follow with Western blotting using specific antibodies against ODV-E56 and other PIFs

    • Compare migration patterns between wild-type and mutant viruses

  • Co-immunoprecipitation (Co-IP):

    • Generate antibodies against ODV-E56 or use epitope-tagged constructs

    • Prepare ODV membrane protein extracts under non-denaturing conditions

    • Perform immunoprecipitation using antibodies against ODV-E56

    • Analyze precipitated proteins by SDS-PAGE followed by Western blotting or mass spectrometry

    • Verify interactions with reciprocal Co-IPs

  • Crosslinking Studies:

    • Treat purified ODVs with chemical crosslinkers of various spacer lengths

    • Analyze crosslinked products by SDS-PAGE and Western blotting

    • Identify crosslinked partners by mass spectrometry

    • Use specific antibodies to confirm the identity of interacting proteins

  • Yeast Two-Hybrid Screening:

    • Clone the odv-e56 gene into appropriate yeast expression vectors

    • Screen against a library of other viral proteins

    • Validate positive interactions using alternative methods

    • Map interaction domains through deletion constructs

Research has shown that unlike other PIF proteins (P74, PIF1, PIF2, PIF3, PIF4, and P95) which form a stable complex, ODV-E56 (PIF5) appears to function independently. This was determined through blue native PAGE analysis, where PIF5 was found to be separate from the PIF complex . This independence suggests distinct functional roles that require further investigation.

What considerations are essential when designing experiments to study ODV-E56 evolutionary selection?

When designing experiments to study evolutionary selection on ODV-E56, researchers should implement a comprehensive approach:

  • Sequence Collection and Alignment:

    • Gather odv-e56 sequences from diverse virus isolates across geographical regions

    • Include sequences from related virus species for comparative analysis

    • Perform multiple sequence alignment using appropriate algorithms (e.g., MUSCLE or MAFFT)

    • Manually inspect and refine alignments to ensure accuracy

  • Selection Analysis Methods:

    • Calculate nonsynonymous (dN) and synonymous (dS) substitution rates

    • Apply multiple selection detection methods to avoid false positives:

      • Site-specific methods (PAML, FEL, SLAC, REL)

      • Branch-specific methods to detect lineage-specific selection

      • Branch-site methods to identify sites under selection in specific lineages

    • Set appropriate statistical thresholds (typically p < 0.05 or posterior probability > 0.95)

  • Structural and Functional Correlation:

    • Map selected sites onto predicted protein structures

    • Analyze whether selected sites correspond to known functional domains

    • Evaluate whether amino acid changes alter physicochemical properties (charge, hydrophobicity)

    • Consider the potential impact on protein-protein interactions or host recognition

  • Experimental Validation:

    • Generate recombinant viruses with site-directed mutations at positively selected sites

    • Test the effect of these mutations on:

      • Oral infectivity across different host species

      • Binding and fusion capabilities

      • Protein-protein interactions

    • Compare phenotypic effects with evolutionary predictions

  • Host Range Correlation:

    • Correlate sequence variations with documented host range differences

    • Test virus isolates with varying odv-e56 sequences against a panel of host species

    • Perform controlled bioassays to determine LC50 values

    • Analyze correlation between specific sequence features and host range breadth

This experimental design approach provides a robust framework for understanding how evolutionary selection on ODV-E56 may influence host range and adaptation in baculoviruses. The analysis of three AnpeNPV strains revealed that odv-e56 was among three genes showing higher evolutionary rates of change (dN/dS > 1), suggesting positive or purifying selection, which aligns with its potential role in host range determination .

What protein purification methods are most effective for isolating ODV-E56 for structural studies?

For isolating ODV-E56 protein for structural studies, researchers should consider the following optimized methodology:

  • Recombinant Expression Systems:

    • Clone the odv-e56 gene into a suitable expression vector (e.g., pET series for bacterial expression or baculovirus expression vectors for insect cell expression)

    • For bacterial expression:

      • Use E. coli BL21(DE3) or similar strains optimized for protein expression

      • Include a His-tag or other affinity tag for purification

    • For insect cell expression:

      • Use Sf9 or High Five cells with a baculovirus expression system

      • Include a secretion signal if necessary

      • Incorporate a cleavable affinity tag

  • Extraction from Viral Particles:

    • Purify occlusion bodies (OBs) from infected insect larvae or cell culture

    • Dissolve OBs in alkaline buffer (e.g., 0.1 M Na₂CO₃, 166 mM NaCl, 10 mM EDTA, pH 10.5)

    • Separate ODVs by centrifugation

    • Extract envelope proteins using non-ionic detergents (e.g., Triton X-100)

  • Chromatography Purification Strategy:

    • Initial capture: Affinity chromatography using tag-specific resins

    • Intermediate purification: Ion exchange chromatography based on ODV-E56's theoretical isoelectric point

    • Polishing step: Size exclusion chromatography to achieve high purity

    • Monitor purification by SDS-PAGE and Western blotting

  • Protein Quality Assessment:

    • Verify purity by SDS-PAGE with silver staining (>95% purity required for structural studies)

    • Confirm identity by Western blotting and mass spectrometry

    • Assess protein homogeneity by dynamic light scattering

    • Verify proper folding by circular dichroism spectroscopy

  • Optimization for Structural Studies:

    • Screen multiple buffer conditions for stability using thermal shift assays

    • Remove flexible regions or tags that may interfere with crystallization

    • For X-ray crystallography: Set up crystallization screens

    • For cryo-EM: Ensure sample homogeneity and concentration

When purifying ODV-E56 from viral particles, the comprehensive analysis of ODV composition by Braunagel et al. demonstrated that this protein can be successfully identified with 46.2% coverage using SDS-PAGE followed by mass spectrometry . This methodological approach provides a foundation for isolation strategies aimed at structural characterization of this important envelope protein.

How can gene editing techniques be applied to study the functional domains of ODV-E56?

Modern gene editing techniques offer powerful approaches to dissect the functional domains of ODV-E56:

  • CRISPR-Cas9 Modification of Baculovirus Bacmids:

    • Design sgRNAs targeting specific regions of the odv-e56 gene

    • Prepare homology-directed repair templates with desired modifications

    • Co-transfect CRISPR components and repair templates into cells containing baculovirus bacmids

    • Screen for edited bacmids using PCR and sequencing

    • Generate virus stocks from confirmed bacmid clones

  • Domain Mapping Through Targeted Mutagenesis:

    • Identify conserved domains through bioinformatic analysis

    • Design a series of mutations:

      • Alanine scanning mutagenesis of conserved residues

      • Domain deletion constructs

      • Domain swap experiments with orthologous proteins

    • Generate recombinant viruses expressing each mutant

    • Assess the impact on oral infectivity through bioassays

    • Evaluate effects on protein localization and interactions

  • Structure-Function Analysis:

    • Predict structural features using computational tools

    • Target predicted functional motifs:

      • Membrane-spanning regions

      • Potential receptor-binding domains

      • Post-translational modification sites

    • Create point mutations or small deletions

    • Test mutants for phenotypic effects in both cell culture and in vivo

  • Functional Complementation Studies:

    • Generate odv-e56 knockout viruses

    • Create a library of truncated or mutated ODV-E56 variants

    • Test each variant's ability to rescue oral infectivity

    • Map minimum functional domains required for activity

    • Assess whether different domains are required for infection of different host species

  • Live Cell Imaging Approaches:

    • Create fluorescent protein fusions with ODV-E56

    • Use site-directed mutagenesis to test the impact of mutations on localization

    • Employ super-resolution microscopy to track protein dynamics during infection

    • Combine with other tagged viral proteins to study co-localization

This methodological framework enables researchers to systematically dissect the structure-function relationships of ODV-E56, building on previous work that has established its critical role in oral infectivity and its independent function from the PIF complex .

What advanced genomic approaches are valuable for studying evolutionary patterns of ODV-E56 across baculovirus species?

To comprehensively study evolutionary patterns of ODV-E56 across baculovirus species, researchers should implement these advanced genomic approaches:

  • Whole Genome Sequencing and Comparative Genomics:

    • Sequence multiple isolates of the same virus species from different geographical regions

    • Employ next-generation sequencing platforms (Illumina, PacBio, Oxford Nanopore)

    • Assemble complete genomes using reference-guided or de novo approaches

    • Perform whole-genome alignment to identify syntenic regions and structural variations

    • Analyze genomic context of odv-e56 to detect potential co-evolution with adjacent genes

  • Phylogenetic Analysis:

    • Construct phylogenetic trees using:

      • Single-gene analysis of odv-e56

      • Multi-gene analysis of conserved genes

      • Whole-genome phylogeny

    • Apply appropriate evolutionary models (maximum likelihood, Bayesian inference)

    • Test for congruence between odv-e56 phylogeny and species phylogeny

    • Investigate potential horizontal gene transfer events

  • Molecular Evolution Analysis:

    • Calculate evolutionary rates using relaxed molecular clock models

    • Identify episodes of positive selection using:

      • Site-specific models (PAML, FUBAR)

      • Branch-site models to detect lineage-specific selection

      • Sliding window analysis to identify regions under selection

    • Detect potential recombination events using methods like RDP, GENECONV, or MaxChi

  • Population Genomics:

    • Sample multiple viral isolates from the same host population

    • Analyze single nucleotide variations (SNVs) in the odv-e56 gene

    • Calculate nucleotide diversity and differentiation statistics

    • Test for signatures of selection or demographic changes

    • Compare intraspecific and interspecific variation patterns

  • Ancestral Sequence Reconstruction:

    • Infer ancestral odv-e56 sequences at key nodes in the phylogeny

    • Synthesize and express these reconstructed genes

    • Test functionality of ancestral proteins

    • Identify key mutations that altered function during evolution

An exemplary application of these approaches is demonstrated in the comparative analysis of three AnpeNPV strains, which revealed that odv-e56 is among three genes showing higher evolutionary rates of change (dN/dS > 1), suggesting positive or purifying selection . Additionally, the analysis of HzNV-2 genome identified Hz2V062 as encoding an ODV-E56 structural protein homolog with significant similarity to Gryllus bimaculatus nudivirus ODV-E56 (E-value of 2 × 10^-9), highlighting evolutionary relationships across virus families .

What are the most promising research avenues for understanding the molecular mechanism of ODV-E56 in viral entry?

Based on current knowledge gaps and recent findings, the following research avenues hold significant promise for elucidating ODV-E56's molecular mechanism:

  • Receptor Identification and Characterization:

    • Employ virus overlay protein binding assays (VOPBA) with labeled ODV-E56

    • Use crosslinking approaches coupled with mass spectrometry to identify binding partners

    • Perform co-immunoprecipitation studies with midgut brush border membrane vesicles

    • Validate candidate receptors through gene silencing in susceptible hosts

    • Characterize binding kinetics using surface plasmon resonance or biolayer interferometry

  • High-Resolution Structural Studies:

    • Determine the crystal structure of ODV-E56 alone and in complex with potential receptors

    • Utilize cryo-electron microscopy to visualize ODV-E56 in the context of the virion envelope

    • Employ hydrogen-deuterium exchange mass spectrometry to map dynamic regions

    • Use structural information to guide targeted mutagenesis of functional domains

  • Real-Time Imaging of Viral Entry:

    • Develop fluorescently tagged ODV-E56 that maintains functionality

    • Use live-cell super-resolution microscopy to track viral entry in real-time

    • Apply correlative light and electron microscopy to connect function with ultrastructure

    • Implement single-particle tracking to follow individual virions during entry

  • Investigation of ODV-E56's Relationship to the PIF Complex:

    • Further characterize the independence of ODV-E56 from the PIF complex

    • Determine if transient interactions occur during specific stages of infection

    • Investigate potential sequential actions of ODV-E56 and the PIF complex

    • Test whether ODV-E56 and the PIF complex can functionally complement each other

  • Comparative Host Range Studies:

    • Test recombinant viruses with ODV-E56 variants against expanded host panels

    • Correlate specific sequence features with host range phenotypes

    • Investigate host-specific differences in midgut receptor binding

    • Explore co-evolutionary patterns between ODV-E56 and host receptors

The finding that PIF5 (ODV-E56) functions separately from the PIF complex that contains other per os infectivity factors suggests a distinct role in the infection process . This observation, combined with evidence that ODV-E56 is essential for oral infectivity while not affecting budded virus production , points to specialized functions during the initial stages of infection that warrant detailed mechanistic investigation.

These research directions provide a roadmap for unraveling the molecular basis of ODV-E56 function, potentially leading to applications in biotechnology and pest management.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.