Recombinant Hemagglutinin 1 (hag1)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
hag1; Hemagglutinin 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-300
Protein Length
full length protein
Species
Eikenella corrodens
Target Names
hag1
Target Protein Sequence
MVSALSCTHERRCYAIRTHLLQNYAGMGLSHYSGSSFVAAQHTGWYLRQAARIARAAEVF
ELQEDGTVLAEHILQPDSGVWTLYPQAQHKVEPLDDDFAVQLEFHCEKADYFHKKHGMTT
THSAIREAVQTVAPCKTLDLGCGQGHNALFLSLAGYDVRAVDHSPAAVASVLDMAAREQL
PLRADAYDINAAALNEDYDFIFATVVFIFLQAGRVPEIIADMQAHTRPGGYNLIVSAMDT
ADYPCHMPFSFTFKEDELRQYYADWELLKYEEAVGLMHATDAQGRPIQLKFVTMLAKKPG
Uniprot No.
Target Background
Function
Induces agglutination of neuraminidase-treated erythrocytes.
Subcellular Location
Cell membrane; Single-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
