Recombinant Heme A synthase (ctaA)

Shipped with Ice Packs
In Stock

Description

Catalytic Mechanism and Reaction Pathway

Recombinant CtaA from Bacillus subtilis performs two consecutive monooxygenation reactions to transform the C8 methyl group of heme O into a formyl group, yielding heme A . Key findings include:

  • Hydroxylation steps: The reaction intermediate hydroxymethyl heme O (heme I) was trapped in the H216M mutant variant of CtaA, confirming the proposed two-step mechanism .

  • Oxygen dependency: Activity requires molecular oxygen, but isotopic labeling shows the formyl oxygen does not originate from O₂ .

  • Bound hemes: Purified CtaA contains tightly associated heme B (protoheme IX) and heme A, with redox potentials of +242 mV (heme A) and low-spin states observed via electron paramagnetic resonance .

Table 1: Functional Roles of Histidine Residues in B. subtilis CtaA

ResidueMutationImpact on ActivityHeme Binding
His-60H60L/MLoss of activityRetains heme O/B
His-123H123L/MReduced activityBinds heme O
His-216H216MTraps heme IBinds heme I/O
His-278H278L/MMinimal effectReduced heme retention
  • His-60, His-123, and His-216 are critical for catalysis, while His-278 stabilizes heme binding .

  • The H216M variant provided direct evidence for heme I as a reaction intermediate .

Expression Systems and Purification

Recombinant CtaA has been overproduced in B. subtilis and Escherichia coli:

  • Affinity purification: His-tagged CtaA from B. subtilis yielded 0.2–0.5 mg protein/L culture, containing heme B (0.2 mol/mol protein) and trace heme A .

  • Heterologous expression: E. coli expressing B. subtilis ctaA produced functional enzyme but required co-expression with heme O synthase (CtaB) .

Biological Roles Beyond Heme A Synthesis

  • Metabolic impact: In Bacillus cereus, CtaA deletion disrupted cytochrome caa₃ oxidase activity, altering carbon metabolism (e.g., increased acetate overflow on glucose, impaired glycerol utilization) .

  • Biofilm dynamics: B. cereus ΔctaA showed delayed biofilm formation and reduced motility, linking heme A synthesis to surface adaptation .

  • Sporulation: B. subtilis CtaA is essential for sporulation, likely due to its role in cytochrome caa₃ assembly .

Comparative Analysis with Other Species

OrganismCtaA FunctionKey Phenotype of ΔctaA
B. subtilisHeme A synthesis for cytochrome caa₃Sporulation defect
B. cereusCytochrome caa₃ biogenesisBiofilm dysregulation
Staphylococcus aureusTerminal oxidase maturationReduced virulence

Interactions with Chaperones

  • Surf1 proteins: Human Surf1 homologs bind heme A with submicromolar affinity (Kd = 303–650 nM), requiring a conserved histidine residue (His-193 in Surf1c) for ligation .

  • Thermodynamic data: Isothermal titration calorimetry revealed exothermic binding (ΔH = -11.6 to -21.1 kcal/mol), highlighting Surf1’s role in heme A delivery to oxidases .

Table 2: Key Plasmids and Strains for CtaA Studies

Plasmid/StrainDescriptionReference
pCTHI10B. subtilis ctaA overexpression vector
LMT20RB. subtilis ΔctaA mutant
pSPC1(−)Spectinomycin resistance marker

Unresolved Questions

  • Heme-binding sites: Whether CtaA uses one or two heme groups during catalysis remains unclear .

  • Electron transfer role: The functional significance of bound heme B in CtaA is not fully understood .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order remarks. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate this in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
ctaA; STH2618; Heme A synthase; HAS; Cytochrome aa3-controlling protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-306
Protein Length
full length protein
Species
Symbiobacterium thermophilum (strain T / IAM 14863)
Target Names
ctaA
Target Protein Sequence
MKALRAVSLANTAVMLLAVLWGAWVTSSDSGDGCGASWPLCKGTFMPDWDYAAIVEFGHR VVSALAGLLSVAVLVWVARVRPSETRLKRLAFGTFFFVVLQGGLGAAAVLRPQPDLVMAL HFGFSLLCFTFALLVTVALGQGERAAFQRPDVSAQPVAPGLRTQIWGLAVYTYLVVYLGA YVRHLGASMACTGWPLCNGELIPPLYGPVGANFAHRLGAALAVVLVLRLWWTARRLTERD DLRRGAAWALALMAAQVASGALFPLGYLNLLTQLLHTGLITGFWGVLSYLCYLTLPVGRE TVAVSA
Uniprot No.

Target Background

Function
Catalyzes the oxidation of the C8 methyl side group on heme O porphyrin ring into a formyl group.
Database Links

KEGG: sth:STH2618

STRING: 292459.STH2618

Protein Families
COX15/CtaA family, Type 1 subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Heme A synthase (ctaA) and what reaction does it catalyze?

Heme A synthase (ctaA) is an integral polytopic membrane protein that catalyzes the conversion of a methyl side group on heme O into a formyl group, producing heme A. This enzyme represents the final step in heme A biosynthesis, which is essential for assembly of functional terminal respiratory oxidases in bacteria, archaea, and eukaryotes . In Bacillus subtilis, ctaA is encoded by the ctaA gene located at 133° on the circular chromosome, positioned immediately upstream of the ctaCDEFG gene cluster but transcribed in the opposite direction .

The catalytic mechanism involves two consecutive monooxygenation reactions. First, the methyl side chain on carbon 8 of the porphyrin ring is hydroxylated to form hydroxymethyl heme O (heme I) as an intermediate. A second hydroxylation creates an unstable dihydroxymethyl group that spontaneously decomposes into a formyl group and water . This reaction requires molecular oxygen, although isotope labeling experiments suggest the oxygen atom in the formyl group is not directly derived from O₂ .

Why is Heme A synthase important for cellular respiration?

Heme A synthase plays a crucial role in aerobic respiration by enabling the synthesis of heme A, a highly specialized heme variant that functions as a prosthetic group in terminal respiratory oxidases. In B. subtilis, heme A is incorporated into two terminal oxidases: cytochrome aa₃ (encoded by the qoxABCD operon) and cytochrome caa₃ (encoded by the ctaCDEF gene cluster) . These oxidases are essential components of the respiratory electron transport chain that generates the proton gradient necessary for ATP synthesis.

Interestingly, B. subtilis can grow aerobically even without functional ctaA because it possesses an alternative terminal oxidase, cytochrome bd, which does not require heme A . This property makes B. subtilis an ideal experimental system for studying heme A synthesis and cytochrome a biogenesis without lethal consequences from genetic manipulations .

What is the predicted membrane topology of Heme A synthase?

Based on hydropathy profile analysis, the positive-inside rule, and topology studies using alkaline phosphatase fusions, the B. subtilis CtaA polypeptide is predicted to contain eight membrane-spanning α-helical segments with its N-terminus exposed on the negative (cytoplasmic) side of the membrane . This complex membrane topology is essential for its function in converting heme O to heme A.

Four invariant histidine residues (His-60, His-123, His-216, and His-278) that are conserved across CtaA orthologs are all predicted to be located close to the positive (extracytoplasmic) side of the membrane . These histidine residues are particularly significant because histidines often function as axial ligands to heme iron in proteins, suggesting their potential role in substrate binding or catalysis .

Which expression systems can be used for recombinant ctaA production?

Both homologous and heterologous expression systems have proven effective for recombinant ctaA production:

  • Homologous expression in B. subtilis: Using plasmids like pHP13 derivatives (e.g., pCTA1302 containing the ctaA gene), researchers have successfully overproduced CtaA in its native host . This approach offers the advantage of native membrane environment and processing machinery.

  • Heterologous expression in E. coli: B. subtilis ctaA has been successfully expressed in E. coli, producing a functional enzyme that catalyzes heme A synthesis from heme O . This system provides higher protein yields and simpler genetic manipulation but may face challenges with proper membrane insertion.

Co-expression with ctaB (heme O synthase) can enhance functional ctaA production since heme O serves as both substrate and potentially a cofactor for ctaA .

What are the spectroscopic characteristics of purified recombinant ctaA?

Purified recombinant ctaA exhibits distinctive spectroscopic properties that reflect its heme content:

  • Reduced state absorption: When reduced, the enzyme shows light absorption maxima at 428, 528, and 558 nm, with a split alpha-band characteristic of a low-spin b-type cytochrome .

  • Heme composition: Two types of preparations have been isolated - cyt b-CTA containing heme B and small amounts of heme A, and cyt ba-CTA containing approximately equal amounts of heme B and heme A .

  • Spin state: The iron atoms of heme B and heme A in isolated oxidized CtaA are in the low-spin state, with electron paramagnetic resonance g max signals at 3.7 and 3.5, respectively .

These spectroscopic properties provide valuable tools for assessing enzyme purity, folding, and potential activity during purification and characterization studies.

How much heme is incorporated into purified recombinant ctaA?

Purified recombinant ctaA typically contains substoichiometric amounts of heme. Studies have reported approximately 0.2 mol of heme B per mol of CtaA polypeptide in preparations from both B. subtilis and E. coli membranes, along with smaller amounts of heme A . The substoichiometric heme content (≤0.4 mol of heme per mol of CtaA polypeptide) observed in isolated CtaA raises questions about whether this represents the native state or results from limitations in the overexpression system .

How can site-directed mutagenesis be used to study ctaA function?

Site-directed mutagenesis provides powerful insights into ctaA structure-function relationships. A systematic approach involves:

  • Target selection: Focus on highly conserved residues, particularly the four invariant histidines (His-60, His-123, His-216, and His-278) that are predicted to be located near the positive side of the membrane .

  • Strategic substitutions: Replace histidines with methionine (which can potentially serve as an axial heme ligand) and leucine (which cannot), allowing discrimination between residues involved in heme binding versus other catalytic functions .

  • Mutation techniques: Employ overlap extension PCR site-directed mutagenesis using specific primers designed to introduce the desired mutations, as demonstrated in the research with primers like H278L, H278L2, H278M, and H278M2 .

  • Expression system: Construct plasmids containing the mutated ctaA genes (e.g., pHxxxL, pHxxxM series) and express them in appropriate host systems for functional analysis .

This approach allows methodical dissection of enzyme function by correlating structural changes with functional outcomes.

What role do conserved histidine residues play in ctaA function?

Mutagenesis studies of the four invariant histidine residues in B. subtilis CtaA have revealed their critical importance:

  • Functional significance: At least three of the four invariant histidine residues (His-60, His-123, His-216, and His-278) show important functions for heme A synthase activity .

  • Substrate binding: Several of the purified mutant enzyme proteins contained tightly bound heme O, indicating these histidines may be involved in catalysis rather than merely substrate binding .

  • Reaction intermediates: One variant contained trapped hydroxylated heme O (heme I), a postulated enzyme reaction intermediate, providing evidence for the proposed two-step monooxygenation mechanism .

These findings support the hypothesis that these conserved histidines may serve as axial ligands to heme iron or participate directly in the catalytic mechanism of heme A synthesis.

How can researchers create and analyze ctaA deletion mutants?

Creating and analyzing ctaA deletion mutants involves several methodological steps:

  • Construction strategy: Generate a deletion by homologous double-crossover recombination using a DNA fragment spanning the ctaA chromosomal region but carrying a gene for spectinomycin resistance (spc) in place of ctaA .

  • Plasmid construction: Create specialized plasmids (e.g., pSPC1(+/-), pDCTA1, pDCTA2) containing the appropriate targeting sequences and resistance markers .

  • Transformation and selection: Transform B. subtilis with the constructed plasmid and select for spectinomycin-resistant colonies that have undergone the desired recombination event .

  • Phenotypic analysis: Evaluate the impact of ctaA deletion on:

    • Heme A content using spectroscopic methods

    • Terminal oxidase activity

    • Growth characteristics under various conditions

This approach allows researchers to establish the baseline phenotype against which point mutations can be compared.

What is the proposed catalytic mechanism of Heme A synthase?

The catalytic mechanism of Heme A synthase involves a complex oxidation process:

  • Substrate reaction: The enzyme catalyzes the conversion of a methyl side chain on carbon 8 of the porphyrin ring of heme O to a formyl group through two consecutive monooxygenation reactions .

  • Reaction steps:

    • First hydroxylation: The methyl group is converted to a hydroxymethyl group, forming hydroxymethyl heme O (heme I) as an intermediate

    • Second hydroxylation: Further oxidation creates an unstable dihydroxymethyl group

    • Spontaneous decomposition: This unstable group breaks down into a formyl group and a water molecule

  • Oxygen requirement: The reaction requires molecular oxygen, but surprisingly, isotope labeling experiments suggest the oxygen atom of the formyl group is not directly derived from molecular oxygen .

  • Novel features: B. subtilis heme A synthase lacks the biochemical and amino acid sequence characteristics of P450-type enzymes that typically activate molecular oxygen, suggesting it employs a novel catalytic mechanism .

The trapping of hydroxylated heme O in specific mutant variants provides strong experimental evidence supporting this proposed mechanism .

What cofactors are required for ctaA enzymatic activity?

The cofactor requirements for ctaA activity present an interesting biochemical puzzle:

  • Heme as both substrate and potential cofactor: Heme O serves as the substrate, but may also function as a cofactor in the enzyme, similar to heme oxygenase where heme B plays dual roles .

  • Limited metal content: Less than 0.02 mol of copper and non-heme iron atoms per mol of polypeptide has been found in isolated B. subtilis CtaA .

  • Oxygen requirement: Molecular oxygen is essential for the reaction, as demonstrated by studies showing heme A synthase activity depends on the presence of O₂ .

In the absence of other identifiable cofactors, it appears reasonable to propose that heme iron itself forms part of the catalytic center of heme A synthase . This represents a novel enzyme mechanism distinct from typical monooxygenases.

How can researchers distinguish between heme A, heme O, and reaction intermediates?

Distinguishing between different heme species is essential for monitoring ctaA activity:

  • Spectroscopic methods: Each heme type exhibits characteristic absorption spectra that can be measured by UV-visible spectrophotometry:

    • Heme A: Distinctive absorption peaks in reduced minus oxidized difference spectra

    • Heme O: Spectral features similar to heme B but with differences in peak positions

    • Hydroxylated intermediates: Subtle spectral shifts relative to substrate heme O

  • HPLC analysis: Extraction and chromatographic separation of hemes provides definitive identification and quantification of different heme species.

  • Mass spectrometry: Can identify the precise chemical modifications and differentiate between heme O, hydroxymethyl heme O (heme I), and heme A based on molecular weight differences.

  • Enzyme variants: Specific mutant variants of ctaA can trap reaction intermediates, providing valuable tools for identifying the hydroxylated heme O intermediate in the reaction pathway .

These complementary approaches allow researchers to monitor the conversion of heme O to heme A and identify reaction intermediates with high specificity.

How does the study of ctaA contribute to understanding respiratory chain assembly?

Research on ctaA provides critical insights into respiratory chain assembly:

  • Terminal oxidase biogenesis: CtaA may play a direct role in the assembly of cytochrome a by mediating heme A insertion into the QoxA and CtaD proteins in the B. subtilis membrane .

  • Coordination with heme O synthesis: The genomic organization in B. subtilis places ctaA near ctaB (heme O synthase) with overlapping promoter regions, suggesting coordinated regulation of these sequential enzymes .

  • Alternative pathways: The viability of ctaA-deficient mutants due to the presence of cytochrome bd terminal oxidase demonstrates the flexibility and redundancy in respiratory systems .

Understanding how heme A is synthesized and incorporated into terminal oxidases provides a window into the broader processes of respiratory complex assembly and membrane protein biogenesis.

What can comparative studies of ctaA orthologs reveal about enzyme evolution?

Comparative analysis of ctaA orthologs offers valuable evolutionary insights:

  • Conserved features: The presence of nine highly invariant residues, including four histidines, across ctaA orthologs from bacteria to humans suggests fundamental mechanistic constraints .

  • Taxonomic distribution: CtaA orthologs exist in diverse organisms including eubacteria, archaea, yeast, and humans, indicating the ancient evolutionary origin of this enzyme .

  • Structure-function relationships: Comparing the effects of equivalent mutations across different species can reveal which functional elements have been preserved through evolution and which have diverged.

This comparative approach can identify both universal mechanistic principles and species-specific adaptations in heme A biosynthesis.

What experimental challenges remain in ctaA research?

Despite significant progress, several experimental challenges persist in ctaA research:

  • Complete structural characterization: The membrane-bound nature of ctaA makes obtaining high-resolution structural data challenging. Advanced techniques like cryo-electron microscopy might help overcome this limitation.

  • Full heme incorporation: Even optimized expression systems yield substoichiometric heme incorporation (≤0.4 mol per mol of protein), suggesting either incomplete cofactor assembly or experimental limitations .

  • Reaction intermediates: While hydroxymethyl heme O has been trapped in specific mutants, capturing other transient species in the reaction mechanism remains challenging .

  • Protein-protein interactions: The potential role of ctaA in directly transferring heme A to terminal oxidases suggests protein-protein interactions that have not been fully characterized .

  • Regulatory mechanisms: The overlapping promoter regions of ctaA and ctaB suggest complex regulatory interactions that require further investigation .

Addressing these challenges will require innovative experimental approaches and may yield surprising new insights into this ancient and essential enzyme.

What purification strategies are most effective for recombinant ctaA?

Purifying membrane-bound ctaA requires specialized approaches:

  • Affinity purification: Development of affinity purification procedures has enabled isolation of preparative amounts of CtaA from B. subtilis .

  • Detergent selection: Careful choice of detergents for membrane solubilization is critical for maintaining protein structure and activity.

  • Buffer optimization: Storage in Tris-based buffer with 50% glycerol has been reported to stabilize the purified protein .

  • Temperature considerations: Purification at reduced temperatures helps prevent protein denaturation and loss of bound hemes.

  • Preparation types: Two distinct preparations have been characterized: cyt b-CTA (containing heme B and small amounts of heme A) and cyt ba-CTA (containing approximately equal amounts of heme B and heme A) .

The specific approach must be tailored to the experimental goals, whether studying enzyme mechanism, protein-protein interactions, or structure-function relationships.

How can researchers overcome challenges in functional expression of membrane proteins like ctaA?

Successful expression of functional ctaA requires addressing several challenges:

  • Expression level optimization: Controlling expression rates prevents overwhelming membrane insertion machinery and protein aggregation.

  • Heme availability: Co-expression with heme biosynthesis enzymes or supplementation with heme precursors can increase cellular heme availability.

  • Host selection: Choosing between homologous (B. subtilis) and heterologous (E. coli) expression systems involves tradeoffs between native processing and yield .

  • Growth conditions: Optimizing media composition, oxygen availability, and temperature affects both expression levels and proper folding/heme incorporation.

  • Plasmid design: Specialized vectors like pHP13 derivatives provide appropriate promoters and copy numbers for balanced expression .

These strategies must be combined and optimized for each specific experimental context.

What analytical methods provide the most informative assessment of recombinant ctaA quality?

Multiple complementary methods provide comprehensive quality assessment:

  • Absorption spectroscopy: Characteristic peaks at 428, 528, and 558 nm in the reduced state confirm proper heme incorporation and folding .

  • Heme quantification: Determining the ratio of heme B and heme A to protein provides critical information about cofactor incorporation efficiency.

  • Electron paramagnetic resonance: Confirming the low-spin state of incorporated hemes (g max signals at 3.7 and 3.5 for heme B and heme A, respectively) validates proper heme environment .

  • Activity assays: Measuring conversion of heme O to heme A provides the ultimate assessment of functional integrity.

  • Oligomeric state analysis: Determining whether the purified protein exists as a monomer or higher-order complex helps assess native-like assembly.

These analytical approaches together provide a multi-dimensional assessment of recombinant ctaA quality for research applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.