Recombinant Heme transporter hrg-1 (hrg-1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributors.
Please note: Our proteins are standardly shipped with blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you require a specific tag type, please inform us. We will prioritize developing the specified tag.
Synonyms
hrg-1; R02E12.6; Heme transporter hrg-1; Heme-responsive gene 1 protein; CeHRG-1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-194
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
hrg-1
Target Protein Sequence
MHQIYSSDVSSITSKSSIAKAEIITMEEEQQRQSCCTWFHSLKVQIWIAWLGVSAGVMAG TVFAIQYQNWIAVTMCFISSGFATLVLHLHLAYKKTQMAGWSETRLRCLAAVGATVSFLS FIAMVFCLVVAGIEHQTLDKQGLMGANLWIAAVWFFMTSKWSALTWRFARKYRAFCEESQ PLLAAAPPEYSVTI
Uniprot No.

Target Background

Function
Heme transporter that regulates intracellular heme availability through the endosomal or lysosomal compartment.
Gene References Into Functions
  1. A model where heme translocation across membranes is facilitated by conserved amino acids positioned on the exoplasmic, cytoplasmic, and transmembrane regions of HRG-1-related proteins. PMID: 22174408
  2. hrg-1 is a heme-responsive element that mediates transcriptional regulation in Caenorhabditis elegans. PMID: 20938051
  3. Identification of HRG-1 protein in C. elegans; these proteins are crucial for heme homeostasis and normal development. PMID: 18418376
Database Links

KEGG: cel:CELE_R02E12.6

STRING: 6239.R02E12.6.3

UniGene: Cel.6099

Protein Families
HRG family
Subcellular Location
Endosome membrane; Multi-pass membrane protein. Lysosome membrane; Multi-pass membrane protein.
Tissue Specificity
Specifically expressed in the intestinal cells in larvae and adults.

Q&A

What is the primary function of HRG-1 in cellular biology?

HRG-1 functions as a transmembrane heme permease that transports heme from the phagolysosome to the cytoplasm during erythrophagocytosis in macrophages of the reticuloendothelial system. This process is fundamental to mammalian iron metabolism, as approximately five million red blood cells are recycled every second through this pathway in adult humans. HRG-1 specifically localizes to the phagolysosomal membranes during erythrophagocytosis, allowing for efficient heme transport across these membranes. Depletion of HRG-1 in mouse macrophages causes significant attenuation of heme transport from the phagolysosomal compartment, highlighting its essential role in this process . Additionally, HRG-1 is present in endosomes but not in lysosomes, and it traffics to the plasma membrane upon nutrient withdrawal in mammalian cells, suggesting a role in cellular response to nutritional status .

How is HRG-1 distributed across different tissues in mammals?

HRG-1 exhibits a specific tissue distribution pattern that aligns with its functional role in heme metabolism. Immunohistochemistry studies using polyclonal antibodies against the 18 amino acid cytoplasmic C-terminus of human HRG-1 have revealed high expression levels in macrophages of the spleen, liver, and bone marrow in both wildtype 129SvEv/Tac mice and humans. These tissues constitute the reticuloendothelial macrophage system responsible for recycling heme iron from effete red blood cells. Immunoblotting with HRG-1 antisera detects a ≈15 kDa band corresponding to the predicted molecular weight of HRG-1 monomers in various human and mouse cell lines . This tissue-specific expression pattern correlates with organs involved in erythrophagocytosis and iron recycling, underscoring HRG-1's specialized role in these processes.

What methods are available for detecting HRG-1 protein expression?

Researchers have developed several validated approaches for detecting HRG-1:

  • Polyclonal antibodies: Generated against the 18 amino acid cytoplasmic C-terminus of human HRG-1 (peptide sequence not specified in the source). These antibodies effectively detect HRG-1 in immunoblotting and immunohistochemistry applications .

  • Monoclonal antibodies: Developed using the peptide CHRYRADFADISILSD (amino acids 130-145) conjugated to keyhole limpet hemocyanin to immunize BALB/c mice, followed by generation of hybridoma cell lines. These antibodies are purified with immobilized protein A and can be used at a 1:250 dilution for both immunofluorescence and immunoblotting .

  • siRNA validation: Knockdown experiments using siRNA against human or mouse HRG-1 result in significant reduction in HRG-1 protein, confirming antibody specificity. This approach serves as an essential negative control for validating detection methods .

  • Immunofluorescence microscopy: Enables visualization of endogenous HRG-1 localization, particularly its recruitment to phagolysosomal membranes during erythrophagocytosis .

When selecting a detection method, researchers should consider the specific experimental goals, the biological system being studied, and the need for quantitative versus qualitative assessment of HRG-1 expression.

How does HRG-1 expression change under different physiological conditions?

HRG-1 expression exhibits dynamic regulation in response to various physiological conditions:

  • Hemolysis induction: When mice are injected with phenylhydrazine (which causes hemolytic anemia through intravascular hemolysis), there is a dramatic increase in HRG-1 expression within resident macrophages of the liver and spleen. Similar results occur when mice are injected with oxidized red blood cells or heme arginate to mimic transient increases in intravascular heme .

  • Nutrient withdrawal: HRG-1 traffics to the plasma membrane upon nutrient withdrawal in mammalian cells, suggesting a role in cellular response to nutritional stress .

  • Developmental regulation: In parasitic nematodes such as Haemonchus contortus, HRG-1 shows high mRNA expression in specific developmental stages, particularly in infective (free-living, ensheathed L3) and parasitic (blood-feeding L4s and adult) stages .

  • Heme availability: HRG-1 transcription is responsive to heme levels. In H. contortus, adding haemin chloride (20 μM or 100 μM) to cultures results in a significant decrease in HRG-1 transcription levels in multiple developmental stages (L1s/L2s, adult females, and adult males), demonstrating negative regulation by environmental heme .

These expression patterns highlight HRG-1's role as a responsive component of heme homeostasis mechanisms across different biological contexts.

What experimental approaches can be used to study HRG-1-mediated heme transport?

Several sophisticated experimental approaches have been developed to investigate HRG-1-mediated heme transport:

  • siRNA knockdown coupled with marker analysis: Researchers can deplete HRG-1 using siRNA (>75% reduction) and monitor downstream markers of heme and iron availability. Key markers include Hmox1 (heme oxygenase-1) and Fpn1 (ferroportin-1) mRNA expression, which are attenuated following HRG-1 knockdown during erythrophagocytosis. Ferritin accumulation also shows a concomitant reduction .

  • Iron chelation experiments: Using deferoxamine (DFO) during knockdown experiments helps distinguish between heme and iron regulation pathways, confirming HRG-1's specific role in heme transport .

  • Fluorescent heme analogue uptake: Cellular uptake of fluorescent heme analogues can be measured to quantify HRG-1-mediated transport. This approach has demonstrated that HRG-1 enhances heme uptake in a V-ATPase-dependent manner .

  • Spectrophotometric analysis: Maximum absorbance measurements for heme (386 nm) versus heme+HRG-1 (408 nm) can detect the direct interaction between HRG-1 and heme molecules .

  • Heterologous expression systems: HRG-1 function can be studied in complementary model organisms, including yeast and C. elegans, providing multiple experimental platforms for functional characterization .

These methods collectively provide a robust toolkit for dissecting the molecular mechanisms of HRG-1-mediated heme transport across different experimental systems.

How does the molecular structure of HRG-1 relate to its function?

The structure-function relationship of HRG-1 reveals important insights about its mechanism:

Species ComparisonRMSD ValueStructural Similarity to H. contortus HRG-1
Nematode orthologs≤ 1.17High conservation
Mammalian orthologs≥ 1.257Distinct structure
Among parasitic nematodes (clades I, III, IV, V)1.065High conservation

These structural insights provide a foundation for understanding how HRG-1 accomplishes its heme transport function and suggest potential targets for structure-based interventions.

What is the relationship between HRG-1 and V-ATPase in endosomal function?

The functional relationship between HRG-1 and V-ATPase represents a sophisticated aspect of endosomal biology:

  • Physical interaction: Yeast two-hybrid screening has identified that HRG-1 physically interacts with the c subunit of the V-ATPase. This interaction was discovered using the MATCHMAKER yeast two-hybrid system with pGBKT7-HRG-1 as bait to screen a human fetal brain library .

  • Functional enhancement: HRG-1 enhances V-ATPase activity in isolated yeast vacuoles, suggesting it plays a role in regulating the function of this proton pump .

  • Endosomal acidification: Cells with suppressed HRG-1 show decreased endosomal acidity and impaired V-ATPase assembly. This indicates that HRG-1 contributes to maintaining the acidic environment necessary for proper endosomal function .

  • Reciprocal regulation: HRG-1-dependent heme transport appears to be V-ATPase-dependent, creating a functional interdependence between these two membrane proteins .

  • Impact on receptor trafficking: Suppression of HRG-1 with siRNA causes impaired endocytosis of transferrin receptor, while overexpression of HRG-1 enhances transferrin receptor endocytosis. This demonstrates HRG-1's broader role in receptor trafficking beyond just heme transport .

This relationship between HRG-1 and V-ATPase reveals a mechanistic connection between heme transport and endosomal acidification, suggesting that these processes are coordinated at the molecular level to maintain proper endolysosomal function.

How do missense polymorphisms affect HRG-1 function?

Missense polymorphisms in HRG-1 can significantly impact its function as a heme transporter:

  • Transport deficiency: Research has demonstrated that certain missense polymorphisms in human HRG-1 are defective in heme transport. This functional impairment directly affects the protein's ability to export heme from the phagolysosome, potentially disrupting iron recycling .

  • Experimental validation approaches: To evaluate the functional impact of these polymorphisms, researchers can use:

    • Complementation studies in model systems

    • Cellular heme transport assays with fluorescent heme analogues

    • Measurement of downstream markers (Hmox1, Fpn1, ferritin)

    • Spectrophotometric analysis of heme binding properties

  • Structural implications: Since specific amino acid residues linked to heme transport are invariable across species, missense polymorphisms affecting these conserved residues would likely have the most pronounced functional consequences .

  • Clinical relevance: Given HRG-1's role in iron metabolism, polymorphisms affecting its function could potentially serve as genetic modifiers of human iron metabolism disorders, though this remains to be fully explored clinically .

This area represents an important frontier in HRG-1 research, as identifying and characterizing functional polymorphisms could provide insights into individual variations in iron metabolism and potentially explain some idiopathic cases of iron metabolism disorders.

What role does HRG-1 play in parasitic nematode biology?

HRG-1 serves critical functions in parasitic nematodes, with important evolutionary and functional implications:

  • Conservation and reduction: Parasitic nematodes exhibit a reduced gene set compared to the free-living nematode C. elegans (1-2 orthologs versus 4 in C. elegans). This gene set reduction suggests functional specialization in parasitic species .

  • Structural conservation: Despite the reduced gene count, there is significant structural conservation of HRG-1 proteins among parasitic nematodes (RMSD values ≤ 1.17). This conservation extends across diverse nematode clades (I, III, IV, and V), indicating the fundamental importance of this protein .

  • Developmental regulation: In Haemonchus contortus (barber's pole worm), high mRNA levels of HRG-1 are found in specific developmental stages, particularly in infective (free-living, ensheathed L3) and parasitic (blood-feeding L4s and adult) stages. This expression pattern correlates with the parasite's life cycle and feeding habits .

  • Heme responsiveness: HRG-1 transcription in H. contortus is responsive to environmental heme levels. Adding haemin chloride to cultures results in a significant decrease in HRG-1 transcription in multiple developmental stages, demonstrating that heme availability regulates the expression of this transporter .

  • Potential intervention target: Given its essential role in heme homeostasis and its structural distinctiveness from mammalian orthologs, HRG-1 represents a potential novel anti-parasite intervention target. The differences between parasitic nematode and host mammalian HRG-1 could potentially be exploited for selective targeting .

These findings highlight the importance of HRG-1 in parasitic nematode biology and suggest its potential as a target for developing new antiparasitic strategies.

What are the recommended approaches for studying HRG-1 localization during erythrophagocytosis?

The following methodological approaches are recommended for investigating HRG-1 localization during erythrophagocytosis:

  • Bone marrow-derived macrophage (BMDM) isolation: Isolate BMDM from mice as a primary cell model system for studying erythrophagocytosis. These cells can be cultured ex vivo and provide a physiologically relevant system .

  • Oxidized RBC preparation: Prepare oxidized red blood cells by exposing them to oxidizing agents. Oxidation exposes phosphatidylserine on the outer membrane leaflet, mimicking cellular senescence and enhancing susceptibility to phagocytosis by macrophages .

  • Immunofluorescence microscopy:

    • Fix cells after exposure to oxidized RBCs

    • Use validated anti-HRG-1 antibodies (1:250 dilution)

    • Include appropriate controls (non-phagocytosing cells, latex bead phagocytosis)

    • Analyze using quantitative fluorescence intensity measurements

  • Quantitative analysis: Measure fluorescence signal intensity to quantify HRG-1 recruitment to phagolysosomal membranes specifically during phagocytosis of RBCs compared to controls like latex beads .

  • Co-localization studies: Perform co-localization analysis with markers for endolysosomes to confirm the specific subcellular compartment where HRG-1 localizes .

This methodological approach allows for robust visualization and quantification of HRG-1 dynamics during the erythrophagocytosis process, providing insights into its functional role in this critical aspect of iron metabolism.

How can researchers generate and validate HRG-1 antibodies for experimental studies?

The generation and validation of HRG-1 antibodies require specific methodological considerations:

  • Polyclonal antibody generation:

    • Select a peptide corresponding to amino acid residues 131-146 (HRYRADFADISILSDF) of human HRG-1

    • Conjugate the peptide to keyhole limpet hemocyanin for inoculation

    • Immunize rabbits following standard protocols

    • Affinity-purify antibodies using immobilized peptide

  • Monoclonal antibody production:

    • Use peptide CHRYRADFADISILSD (amino acids 130-145) conjugated to keyhole limpet hemocyanin

    • Immunize BALB/c mice

    • Generate hybridoma cell lines producing HRG-1 monoclonal antibodies

    • Affinity-purify with immobilized protein A

  • Validation protocols:

    • Peptide competition assays to confirm specificity

    • siRNA knockdown experiments showing reduction in detected signal

    • Western blot analysis verifying the expected molecular weight (≈15 kDa)

    • Immunofluorescence microscopy confirming expected subcellular localization

  • Recommended working conditions:

    • Both polyclonal and monoclonal antibodies can be used at a dilution of 1:250 for immunofluorescence and immunoblotting

    • Include appropriate controls (knockdown cells, pre-immune serum)

These methodologies ensure the generation of specific and reliable antibodies for studying HRG-1 expression, localization, and function across various experimental systems.

What in vivo models are effective for studying HRG-1 regulation during hemolysis?

Several in vivo models have proven effective for investigating HRG-1 regulation during hemolysis:

  • Phenylhydrazine-induced hemolytic anemia:

    • Inject mice with phenylhydrazine, which causes hemolytic anemia by damaging circulating erythrocytes

    • This results predominantly in intravascular hemolysis, where released hemoglobin and heme are cleared from circulation by haptoglobin and hemopexin

    • The process creates a net increase in intracellular heme within macrophages of the reticuloendothelial system

    • This model demonstrates dramatic increases in HRG-1 within resident macrophages of the liver and spleen

  • Oxidized RBC injection model:

    • Prepare oxidized RBCs ex vivo

    • Inject them into mice to mimic a transient increase in erythrophagocytosis

    • This model shows consistent increases in HRG-1 expression comparable to the phenylhydrazine model

  • Heme arginate administration:

    • Inject mice with heme arginate to directly increase intravascular heme

    • This approach isolates the heme component of hemolysis without the cellular debris

    • Results show reproducible increases in HRG-1 expression

  • Tissue analysis protocols:

    • Harvest liver and spleen tissues at various time points after treatment

    • Process for immunohistochemistry with HRG-1 antibodies

    • Quantify the intensity of HRG-1 staining in resident macrophages

    • Correlate with markers of hemolysis and heme metabolism

These complementary in vivo models provide robust platforms for investigating HRG-1 regulation in response to various forms of hemolysis and heme overload, offering insights into the physiological regulation of this important transporter.

How can researchers assess the functional impact of HRG-1 knockdown or polymorphisms?

Researchers can employ several methodological approaches to assess the functional consequences of HRG-1 manipulation:

  • siRNA-mediated knockdown:

    • Target HRG-1 with specific siRNAs (>75% depletion efficiency)

    • Conduct experiments in heme-depleted culture media to control baseline heme levels

    • Verify knockdown by both mRNA quantification and protein immunoblotting

  • Downstream marker analysis:

    • Measure mRNA expression of heme-responsive genes:

      • Hmox1 (heme oxygenase-1): Indicates cellular heme availability

      • Fpn1 (ferroportin-1): Reflects iron export capacity

    • Assess protein levels of ferritin as an indicator of intracellular iron storage

    • Compare results between control and HRG-1-depleted cells during erythrophagocytosis

  • Iron chelation experiments:

    • Use deferoxamine (DFO) during knockdown experiments

    • This helps distinguish between direct heme effects and secondary iron effects

    • Observe whether HRG-1 knockdown effects persist in the presence of iron chelation

  • Functional complementation:

    • Express wild-type versus polymorphic/mutant HRG-1 in knockdown cells

    • Assess rescue of phenotypes (marker expression, heme transport)

    • This approach directly links specific protein variants to functional outcomes

  • Heme transport measurement:

    • Use fluorescent heme analogues to quantify transport activity

    • Compare cellular uptake in cells with normal, reduced, or mutant HRG-1 expression

    • This provides a direct measure of HRG-1's primary function

These methodological approaches provide a comprehensive toolkit for assessing the functional impact of HRG-1 manipulation, allowing researchers to connect genetic or expression changes to specific cellular phenotypes related to heme and iron metabolism.

What are the current gaps in HRG-1 research and promising future directions?

  • Clinical implications of HRG-1 polymorphisms: While missense polymorphisms in human HRG-1 have been shown to be defective in heme transport, their prevalence in human populations and potential association with iron metabolism disorders remains largely unexplored. Future studies should investigate whether HRG-1 variants contribute to unexplained cases of iron metabolism disorders or modify the phenotypes of known disorders .

  • Regulatory networks: The upstream regulators and downstream effectors of HRG-1 remain incompletely characterized. Further research into the transcriptional regulation of HRG-1 and its integration into broader iron homeostasis networks would enhance our understanding of how this transporter is controlled in response to various physiological challenges .

  • Structural biology: While comparative modeling has provided insights into HRG-1 structure, high-resolution structural data (e.g., through crystallography or cryo-EM) would significantly advance our understanding of the transport mechanism and potentially enable structure-based drug design for parasitic targets .

  • Therapeutic potential: The structural distinctiveness of nematode HRG-1 from mammalian orthologs suggests potential for selective targeting. Developing compounds that specifically inhibit parasitic HRG-1 could lead to novel antiparasitic treatments with minimal host toxicity .

  • Broader physiological roles: Current research has focused primarily on HRG-1's role in macrophages during erythrophagocytosis, but its presence in other tissues suggests additional functions that warrant exploration. Investigating these potential roles could reveal new aspects of cellular heme homeostasis .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.