Recombinant Heme transporter hrg-4 (hrg-4)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Heme Transporter HRG-4

HRG-4, an abbreviation for Heme Responsive Gene-4, is a transmembrane protein involved in heme transport . It has been identified and characterized in the nematode Caenorhabditis elegans (C. elegans) as well as other species . HRG-4 plays a vital role in heme homeostasis, which is essential for various biological processes, including oxygen transport, cellular respiration, and enzymatic activities . The study of HRG-4 and its homologs has provided valuable insights into the mechanisms of heme uptake, distribution, and utilization in different organisms .

Role in Heme Homeostasis

HRG-4 is crucial for maintaining heme homeostasis within cells and organisms . It regulates heme uptake and distribution, preventing excessive or inadequate heme accumulation, which can be detrimental to cells .

  • Heme Uptake: HRG-4 facilitates the uptake of heme into cells. In C. elegans, HRG-4 is involved in intestinal heme transport .

  • Regulation of Heme Levels: By mediating heme transport, HRG-4 helps maintain optimal intracellular heme concentrations . Dysregulation of heme transporters can lead to conditions such as anemia .

Experimental Evidence and Research Findings

Several studies have provided experimental evidence supporting the role of HRG-4 in heme transport and homeostasis.

ExperimentMethodsResults
RNAi DepletionRNAi to deplete hrgs in C. elegans, exposed to gallium protoporphyrin IX (GaPP)Knockdown of hrg-4 resulted in greater survival of worms exposed to GaPP, indicating reduced transport of the toxic heme analog .
qRT-PCRQuantitative real-time PCR to measure mRNA expression of hrg-4 in response to hemehrg-4 mRNA expression was significantly upregulated by heme, showing its role in heme homeostasis .
Heme Uptake AssaysConducted with ZnMP (zinc mesoporphyrin)RNAi of hrg-4 abrogated ZnMP accumulation in the worm intestine, confirming its role in heme transport .
Transcriptional Fusion AnalysisGenerated transgenic worms expressing hrg-4::gfphrg-4::gfp was expressed specifically in the intestinal cells of larvae and adults, regulated by exogenous heme .
Mutagenesis AnalysisMutated specific amino acids in LHR1, a homolog of HRG-4, and examined phenotypes in yeastHistidine residues, such as His-108 in C. elegans, are necessary for optimal heme uptake. Mutation of the equivalent residue in Leishmania amazonensis LHR1 (His-105) showed no significant phenotype in yeast screens, suggesting other residues may compensate .

Homologs and Related Proteins

HRG-4 has homologs in various organisms, including mammals. The mammalian homolog, HRG1 (Heme Responsive Gene 1), is essential for heme transport during erythrophagocytosis .

  • HRG1 in Mammals: HRG1 mediates heme transport from the phagolysosome of macrophages during erythrophagocytosis . Knockdown of HRG1 reduces ferritin accumulation, demonstrating its role in heme-iron recycling .

  • LHR1 in Leishmania amazonensis: LHR1, a homolog of HRG-4 in Leishmania amazonensis, mediates heme uptake. Mutagenesis analysis has identified key residues involved in heme transport .

Implications for Disease

The disruption of heme homeostasis and HRG-4 function has been implicated in various diseases .

  • Anemia: Dysregulation of heme transporters, including HRG-4, can lead to anemia due to impaired heme uptake and utilization .

  • Infections: Pathogens like Leishmania amazonensis rely on heme transporters like LHR1 (HRG-4 homolog) for survival. Understanding these transporters can provide insights into potential therapeutic targets .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
hrg-4; F36H1.5; Heme transporter hrg-4; Heme-responsive gene 4 protein; CeHRG-4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-207
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
hrg-4
Target Protein Sequence
MTHAFLVIKYYWHIFFVEFSKCTSSTRGSAKKEHVNYRMTAENRGFCQLICHINVRIGWT IFGIVFGISAILTYAIKFHNWSATATTAIATLFACETLYLYWALKKNTIVNWKSSTFQLM IWPNVFIGLLGLLGCLVCYIIAGITHQGAGSIQAMYGENLWFTGSWSLVITKWTWQNAFF ARKYLNKIGTASEDGDIDDDDVEVIKS
Uniprot No.

Target Background

Function
A heme transporter mediating heme uptake across the plasma membrane.
Database Links

KEGG: cel:CELE_F36H1.5

UniGene: Cel.13010

Protein Families
HRG family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the structural topology of HRG-4 and how does it relate to its function?

HRG-4 is a membrane-bound permease with a predicted four transmembrane domain (TMD) topology. Bioinformatic analyses suggest that HRG-4 contains four transmembrane segments, strategically positioned amino acids that are topologically conserved, and specific motifs critical for function. In C. elegans, CeHRG-4 localizes primarily to the plasma membrane where it functions as a heme importer . The protein requires specific amino acid residues for functionality, including a histidine in the exoplasmic (E2) loop and the FARKY motif in the C-terminus for heme transport .

How is HRG-4 regulated in response to environmental heme conditions?

HRG-4 expression demonstrates inverse correlation with environmental heme availability. When environmental heme is low, hrg-4 is highly upregulated in worm intestinal cells, and the protein localizes to the apical surface . This regulation confirms HRG-4 as a member of the heme response gene (HRG) family. Similar to other HRG family members like Leishmania amazonensis LHR1, the transcription of hrg-4 decreases in response to increases in heme concentration, suggesting a feedback regulatory mechanism that fine-tunes heme acquisition based on cellular requirements .

What heterologous expression systems are optimal for recombinant HRG-4 studies?

The Saccharomyces cerevisiae hem1Δ mutant provides an excellent heterologous expression system for studying HRG-4 and related transporters. This yeast strain lacks the ability to synthesize heme and thus mimics the heme auxotrophy of C. elegans, allowing researchers to directly test the heme transport capabilities of HRG-4 . When expressing human HRG-1 in yeast, researchers have found that codon optimization significantly improves expression levels, raising the Codon Adaptation Index from 0.51 to 0.90, resulting in at least 10-fold greater steady-state protein levels . These findings suggest similar codon optimization may benefit recombinant HRG-4 expression in heterologous systems.

What functional assays effectively measure HRG-4-mediated heme transport?

Three complementary approaches have proven effective for measuring heme transport activity of HRG-4:

  • Heme-dependent growth assays: Using hem1Δ yeast strains expressing HRG-4 to measure growth restoration under varying heme concentrations .

  • Ferrireductase enzyme activity: Measuring the activity of heme-dependent Fre1p in yeast cells expressing HRG-4, which correlates with cytoplasmic heme availability .

  • β-galactosidase reporter assays: Using CYC1::lacZ reporter constructs that respond to intracellular heme levels, allowing quantitative measurement of heme import .

These assays provide varying sensitivity, with growth assays generally being less sensitive to residual heme transport activity than enzymatic assays .

Which amino acid residues are critical for HRG-4 heme transport function?

Site-directed mutagenesis studies have identified several critical residues in CeHRG-4 required for optimal heme transport:

Residue/MotifLocationEffect of Alanine SubstitutionFunctional Significance
His-108E2 loopSevere reduction in transportPrimary heme binding site on exoplasmic side
FARKY motifC-terminusSevere reduction in transportCytoplasmic heme binding/transfer
Tyr-63TMD2Moderate reduction in activityFacilitates heme passage through membrane
Tyr-61TMD2No significant effectNot directly involved in transport

Mutation of His-108 to alanine significantly impairs growth in heme-dependent assays and reduces both ferrireductase and β-galactosidase reporter activity . Similarly, mutation of the FARKY motif in the C-terminus substantially reduces transport activity, while Y63A mutations show moderate but consistent reductions in function .

What is the proposed mechanism for heme transport by HRG-4?

Based on experimental evidence, researchers propose the following model for heme transport via HRG-4:

  • A histidine in the E2 loop (His-108 in CeHRG-4) on the extracellular/luminal side initially binds heme.

  • The bound heme is transferred to a histidine or tyrosine in the second transmembrane domain (TMD2) within the transport channel.

  • Heme is subsequently translocated to the cytoplasmic side facilitated by the FARKY motif in the C-terminal tail .

The aromatic and positively charged amino acids in the FARKY motif may serve as heme ligands and stabilize or orient the vinyl and propionic acid side chains of the heme molecule . This mechanism shows similarities to bacterial heme transport systems such as the Helicobacter hepaticus CcsBA cytochrome c synthetase .

How conserved is the HRG-4 transport mechanism across species?

Despite low sequence homology between HRG proteins from different species (approximately 20% identity between human and C. elegans homologs), key structural features and functional mechanisms appear to be highly conserved . Human HRG-1 localizes to similar endocytic compartments as CeHRG-1, has a similar predicted four-TMD topology, and possesses conserved amino acids that are topologically preserved . In human HRG-1, His-56 in TMD2 corresponds functionally to the histidine in CeHRG-1, and mutation of this residue to alanine significantly reduces transport activity . This conservation suggests an evolutionarily ancient heme transport mechanism that predates vertebrate origins .

How does HRG-4 relate to other heme transporters identified in different organisms?

Several heme transporters have been identified across different species:

TransporterOrganismLocalizationFunctionRelation to HRG-4
HRG-4C. elegansPlasma membraneHeme importPrototype HRG family member
HRG-1C. elegans, HumanEndolysosomal compartmentHeme transportFunctionally similar despite low sequence identity
LHR1Leishmania spp.Plasma membraneHeme importMember of HRG family, transcriptionally regulated by heme
TcHTETrypanosoma cruziFlagellar pocketHeme transportMember of HRG family, enhances growth in low-heme conditions
TbHRGTrypanosoma bruceiNot specifiedHeme transportSimilar growth performance in yeast hem1Δ model
FLVCR2HumanPlasma membraneProposed heme importerDifferent family (major facilitator superfamily)

These proteins share similar predicted structures with four transmembrane domains but may differ in their specific mechanisms and regulation . The trypanosomatid proteins TcHTE, LHR1, and TbHRG have all been shown to enhance growth when expressed in S. cerevisiae hem1Δ cells in low-heme media and increase intracellular heme when overexpressed in their native organisms .

How can HRG-4 studies inform therapeutic approaches for parasitic diseases?

Understanding the mechanism of heme transport by HRG-4 and related proteins has significant implications for developing therapeutics against parasites that rely on host heme for survival . Parasites like Trypanosoma cruzi express HRG family proteins such as TcHTE, which plays a critical role in heme transport and is found mainly in the flagellar pocket of epimastigotes . The expression of recombinant TcHTE enhances replication of intracellular amastigotes, likely by increasing heme uptake from the infected cell's cytoplasm . This suggests that inhibitors targeting heme transporters could potentially limit parasite growth by restricting access to this essential nutrient.

What are the current methodological challenges in studying HRG-4 oligomerization states?

Previous studies suggest that HRG-1-related proteins migrate as dimers and trimers on non-denaturing PAGE, indicating that HRG-4 may function as a multimer . This is consistent with other membrane transporters, such as the three-TMD copper transporter Ctr1, which functions as a symmetric trimer to form a channel lined with ligands for copper binding and transport .

Current challenges in studying HRG-4 oligomerization include:

  • Stabilizing membrane protein complexes during isolation and purification

  • Distinguishing functional oligomers from artifacts of the isolation process

  • Determining whether optimal transport function depends on the cumulative contribution from individual heme-binding ligands from each subunit

Advanced approaches such as crosslinking mass spectrometry, blue native PAGE, and single-particle cryo-electron microscopy could help resolve these questions about HRG-4 oligomeric structure and function.

What aspects of HRG-4 regulation remain to be elucidated?

While it is established that HRG-4 expression is regulated by heme availability, the specific molecular mechanisms controlling this regulation remain incompletely understood. Key questions include:

  • What transcription factors are involved in sensing heme levels and regulating HRG-4 expression?

  • Are there post-transcriptional regulatory mechanisms affecting HRG-4 mRNA stability or translation?

  • Does HRG-4 undergo post-translational modifications that affect its transport activity or localization?

Studies in Trypanosoma cruzi have shown that TcHTE mRNA and protein levels decrease in response to increments in heme concentration, confirming it as a member of the HRG family . Similar detailed studies of HRG-4 regulation could provide insights into how organisms maintain heme homeostasis under varying environmental conditions.

How might structural biology approaches advance our understanding of HRG-4 function?

Current knowledge of HRG-4 structure-function relationships is based primarily on mutagenesis studies and computational predictions. Advanced structural biology approaches could significantly enhance our understanding of HRG-4 mechanism by:

  • Determining the three-dimensional structure of HRG-4 using X-ray crystallography or cryo-electron microscopy

  • Identifying conformational changes during the transport cycle using techniques such as hydrogen-deuterium exchange mass spectrometry

  • Characterizing the heme binding sites and the transport pathway through the protein

These approaches could provide a framework for understanding the structural basis of heme transport in eukaryotes and potentially inform the design of selective inhibitors for parasitic HRG homologs .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.