Recombinant Heme transporter hrg-5 (hrg-5)

Shipped with Ice Packs
In Stock

Description

Introduction to Heme Transporter HRG-5

Heme transporter hrg-5 (HRG-5) is a protein encoded by the hrg-5 gene in Caenorhabditis elegans. It belongs to a family of heme transporters that includes other members such as HRG-1, HRG-4, and HRG-6. In C. elegans, these proteins play crucial roles in heme homeostasis, which is particularly important since this nematode cannot synthesize heme endogenously and must acquire it from its environment . HRG-5 is also known as Heme-responsive gene 5 protein or CeHRG-5 in scientific literature . Unlike some of its homologs such as HRG-1 and HRG-4, HRG-5 does not demonstrate transcriptional regulation in response to varying heme concentrations, suggesting it may serve a constitutive function in heme homeostasis .

Key Functional Domains

HRG-5 contains several transmembrane domains that anchor it within cellular membranes, positioning it optimally for heme transport across these barriers. Notably, HRG-5 possesses a histidine residue within one of its transmembrane domains, positioned differently than in its homologs . This histidine is of particular interest as it may be directly involved in the protein's capacity to interact with and transport heme molecules . Histidine residues often coordinate with the iron center of heme, facilitating binding and subsequent transport of this vital molecule.

Heme Transport Role

While the exact mechanism of HRG-5-mediated heme transport remains under investigation, research suggests that it contributes to the sophisticated network of heme trafficking within C. elegans cells. Unlike HRG-1 and HRG-4, which demonstrate upregulated expression under heme-limiting conditions, HRG-5 does not show transcriptional regulation by heme levels . This constant expression pattern suggests that HRG-5 may serve a constitutive function in maintaining baseline heme homeostasis rather than responding to fluctuating heme availability.

Coordination with Other Transporters

HRG-5 functions alongside other heme transporters in C. elegans, including HRG-1, HRG-4, and HRG-6. Together, these proteins form a sophisticated transport network that ensures appropriate heme distribution throughout the organism. While HRG-1 localizes primarily to lysosome-related organelle (LRO) membranes and mobilizes stored heme into the cytoplasm, and HRG-4 facilitates heme import at the plasma membrane, the precise subcellular localization and specific role of HRG-5 within this network continues to be elucidated through ongoing research .

Expression Systems

Recombinant HRG-5 can be successfully expressed in prokaryotic systems, with Escherichia coli being the predominant expression host . The recombinant protein is typically produced with an N-terminal histidine (His) tag, which facilitates purification through affinity chromatography . This approach enables the production of substantial quantities of purified protein for structural and functional studies.

Properties of Purified Recombinant HRG-5

The commercially available recombinant full-length HRG-5 protein exhibits the following characteristics:

PropertyDetails
SpeciesCaenorhabditis elegans
SourceE. coli
TagN-terminal His
Protein LengthFull Length (1-160 amino acids)
FormLyophilized powder
Purity>90% (as determined by SDS-PAGE)
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
Optimal Storage-20°C/-80°C
UniProt IDQ7YTM8

Table 1: Physical and biochemical properties of recombinant HRG-5 protein .

Reconstitution and Handling

For optimal experimental use, recombinant HRG-5 is typically reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL . Addition of glycerol to a final concentration between 5-50% is recommended for long-term storage, with 50% being the standard concentration used in commercial preparations . The reconstituted protein should be aliquoted to avoid repeated freeze-thaw cycles, which can compromise protein integrity and function .

Heme Transport Studies

Recombinant HRG-5 serves as an invaluable tool for investigating mechanisms of heme transport across biological membranes. By studying the structure-function relationships of HRG-5 and comparing it with other heme transporters, researchers can gain insights into the molecular basis of heme trafficking, with potential applications in understanding various heme-related disorders.

Evolutionary Studies

The study of HRG-5 and its homologs provides a window into the evolution of heme acquisition systems, particularly in organisms that cannot synthesize heme endogenously. Comparative analyses between nematode heme transporters like HRG-5 and their counterparts in other species, including parasitic nematodes such as Brugia malayi and Haemonchus contortus, offer valuable insights into evolutionary adaptations for heme utilization .

Drug Development

Understanding the structure and function of HRG-5 may contribute to the development of novel therapeutics targeting heme transport pathways. This is particularly relevant for addressing parasitic infections caused by organisms that rely on host-derived heme for survival.

HRG Family Comparison

HRG-5 belongs to a family of heme transporters in C. elegans that includes HRG-1, HRG-4, and HRG-6. While sharing some structural similarities, these transporters exhibit notable differences in their regulation, localization, and specific functions within the heme transport network:

TransporterHeme RegulationKey Functional ResiduesPrimary LocalizationFunction
HRG-1Upregulated under low hemeHistidine in second transmembrane domain; FARKY motif at C-terminusLysosome-related organellesMobilizes stored heme to cytoplasm
HRG-4Upregulated under low hemeTyrosine in second transmembrane domainPlasma membraneImports environmental heme
HRG-5Not heme-regulatedHistidine at different position in transmembrane domainUnder investigationConstitutive heme transport
HRG-6Not heme-regulatedTyrosine in second transmembrane domainUnder investigationUnder investigation

Table 2: Comparison of key features among C. elegans HRG family proteins .

In Vivo Functional Characterization

Despite our growing understanding of HRG-5's structure and biochemical properties, more detailed in vivo functional characterization is needed to elucidate its precise role within the heme homeostasis network of C. elegans. Future studies using fluorescently tagged HRG-5 and heme analogs could help determine its subcellular localization and trafficking patterns under various physiological conditions.

Therapeutic Applications

Given the essential nature of heme for many parasitic organisms that cannot synthesize it endogenously, HRG-5 and related transporters represent potential targets for anti-parasitic drug development. Future research may focus on identifying small molecules that selectively inhibit these transporters, potentially disrupting heme homeostasis in parasitic nematodes while minimizing effects on host systems.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a particular tag, please inform us, and we will prioritize its development.
Synonyms
hrg-5; F36H1.9; Heme transporter hrg-5; Heme-responsive gene 5 protein; CeHRG-5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-160
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
hrg-5
Target Protein Sequence
MSSKISSSRCCTLFCHVNTRIALTILDILIGFSNILSYAIQFHNWSALTLTAMVTLVACH TLQMFLAEKKNTITHWKYSTFKWIMWIDITLGFLALGCFVVCFIIAGVTEIEFTNLYGEN LWFTGLWATAITKYTWQNALLARNYSNQKRILKSEIVEDA
Uniprot No.

Target Background

Function
Heme transporter.
Database Links

KEGG: cel:CELE_F36H1.9

UniGene: Cel.32350

Protein Families
HRG family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is HRG-5 and what is its fundamental role in heme transport?

HRG-5 functions as a membrane-bound permease that transports heme in C. elegans, an organism that cannot synthesize its own heme (a heme auxotroph). HRG-5 belongs to the HRG-1 family of proteins, which includes four paralogs in C. elegans: HRG-1, HRG-4, HRG-5, and HRG-6. These proteins function somewhat redundantly to ensure that the worm acquires adequate heme to sustain growth and development . Experimental verification of HRG-5's heme transport capacity has been demonstrated using a heme synthesis-defective Saccharomyces cerevisiae (hem1Δ) model system, where expression of HRG-5 significantly enhanced heme-dependent growth, confirming its role as a heme transporter .

Research methodologies to study HRG-5's fundamental role typically employ genetic approaches (knockdowns, knockouts), heterologous expression systems, and heme-dependent growth assays to quantify transport activity.

How does the structure of HRG-5 relate to its function?

While detailed structural information specific to HRG-5 is limited in current literature, structural insights can be extrapolated from the better-characterized HRG-1 family members. HRG-1-related proteins are predicted to contain four transmembrane domains (TMDs) with both N and C termini residing in the cytoplasm . The heme transport mechanism in this family likely involves topologically conserved amino acids that serve as axial ligands for heme binding, particularly histidine, tyrosine, or cysteine residues strategically positioned within the transmembrane domains and loops .

Methodologically, researchers investigating HRG-5 structure should consider membrane topology modeling, site-directed mutagenesis of predicted heme-binding residues, and comparative analyses with other HRG family members to identify conserved structural elements that might be critical for function.

What experimental systems are optimal for studying recombinant HRG-5?

Several experimental systems have proven valuable for studying HRG proteins:

  • Yeast expression systems: Heme synthesis-defective S. cerevisiae (hem1Δ) provides an excellent model for functional characterization as these mutants require exogenous heme for growth. Expression of functional heme transporters in this system enables growth assessment in heme-limited conditions .

  • Mammalian cell expression: For studies requiring post-translational modifications more similar to metazoan systems.

  • In vitro reconstitution: Purified recombinant protein can be incorporated into liposomes for direct transport assays.

When working with recombinant HRG-5, researchers should consider codon optimization for the chosen expression system, as demonstrated with human HRG-1, where codon optimization for yeast significantly improved expression levels . Subcellular localization should be confirmed with epitope tagging followed by immunofluorescence microscopy to ensure proper trafficking of the recombinant protein.

How does HRG-5 cooperate with other HRG family members?

In C. elegans, the four HRG paralogs (HRG-1, HRG-4, HRG-5, and HRG-6) likely function with some redundancy to ensure adequate heme acquisition . This cooperative function is particularly important since C. elegans cannot synthesize heme and must acquire it from the environment or diet.

To study the cooperative nature of these transporters, researchers typically employ:

  • Double or multiple knockout/knockdown approaches

  • Rescue experiments where individual transporters are expressed in mutant backgrounds

  • Growth assays in heme-limited conditions

  • Quantitative transport assays to measure the contribution of each transporter

Experimental evidence suggests that multiple HRG proteins enhance heme-dependent growth in yeast models, indicating that they can function independently but may have complementary roles in the organism .

What are the critical amino acid residues for HRG-5-mediated heme transport?

Based on studies of other HRG family members, specific amino acids are likely critical for HRG-5 heme transport. In HRG-1 and HRG-4, strategically located histidine residues play essential roles. For example, CeHRG-1 requires a specific histidine in the second transmembrane domain (TMD2) and the FARKY motif in the C terminus for heme transport, while CeHRG-4 utilizes a histidine in the exoplasmic (E2) loop and the FARKY motif .

To identify critical residues in HRG-5, researchers should:

  • Perform sequence alignments with HRG-1 and HRG-4 to identify conserved residues

  • Use site-directed mutagenesis to modify potential heme-binding ligands

  • Assess transport activity using functional complementation in yeast systems

  • Employ biophysical methods to measure direct heme binding

It would be particularly important to examine whether HRG-5 contains histidine residues in positions topologically equivalent to those in HRG-1 (TMD2) and HRG-4 (E2 loop), as well as to determine if the C-terminal FARKY motif is conserved in HRG-5 .

What challenges exist in producing functionally active recombinant HRG-5?

Production of functional recombinant membrane proteins like HRG-5 presents several challenges:

  • Expression level optimization: As observed with human HRG-1, codon optimization for the expression system can dramatically improve protein yield. For example, codon optimization of human HRG-1 for yeast expression increased protein levels approximately 10-fold .

  • Proper folding and membrane insertion: Membrane proteins require specialized chaperones and insertion machinery, which may vary between expression systems.

  • Post-translational modifications: If glycosylation or other modifications are required for function, the expression system must be capable of providing these.

  • Protein purification: Extraction from membranes requires detergents that must maintain protein structure and function.

A methodological approach would include:

  • Testing multiple expression systems (bacterial, yeast, insect, mammalian)

  • Optimizing codons for the chosen expression system

  • Adding purification tags that minimally impact function

  • Verifying proper localization through microscopy or fractionation

  • Confirming functionality through transport assays

How can researchers quantitatively measure HRG-5-mediated heme transport?

Several methodological approaches can be employed to quantitatively assess HRG-5-mediated heme transport:

  • Complementation growth assays: Using heme-deficient yeast strains (hem1Δ), growth rate in varying heme concentrations can provide a quantitative measure of transport efficiency .

  • Enzymatic activity of heme-dependent proteins: Measuring ferrireductase activity or CYC1::LacZ reporter activity in yeast expressing HRG-5, as has been done for other HRG proteins .

  • Direct heme measurements: Using zinc mesoporphyrin IX (ZnMP), a fluorescent heme analog, to track uptake in cells expressing HRG-5.

  • Radioactive heme uptake assays: Using 55Fe-labeled heme to directly measure transport kinetics.

  • In vitro liposome reconstitution: Purified protein incorporated into liposomes with encapsulated fluorescence quenchers can provide direct transport measurements.

For example, research with HRG-1 and HRG-4 demonstrated >10-fold and 5-fold increases in ferrireductase activity respectively when expressed in yeast, confirming their ability to import heme that was then incorporated into functional hemoproteins .

What is known about the regulatory mechanisms controlling HRG-5 expression?

While specific information about HRG-5 regulation is limited in the provided search results, it's likely that HRG-5 is regulated by heme availability similar to other HRG family members. Potential regulatory mechanisms may include:

  • Transcriptional regulation: Promoter elements responsive to heme levels

  • Post-transcriptional regulation: mRNA stability controlled by heme levels

  • Post-translational regulation: Protein trafficking, stability, or activity modulated by heme concentration

To investigate regulatory mechanisms, researchers could employ:

  • Promoter-reporter fusion constructs to study transcriptional regulation

  • qRT-PCR to measure mRNA levels under varying heme conditions

  • Western blotting to assess protein levels and post-translational modifications

  • Fluorescently tagged HRG-5 to track subcellular localization in response to heme levels

How do mutations in HRG-5 affect C. elegans phenotypes in vivo?

To study the in vivo effects of HRG-5 mutations, researchers can examine several phenotypes in C. elegans:

  • Growth and development: As observed with HRG-1 and HRG-4 deletion mutants, single and double mutants can show growth defects when raised on low heme, which can be quantified using the COPAS BioSort system to measure worm length (time of flight) and optical density (extinction) .

  • Heme-dependent enzyme activities: Measuring activities of heme-dependent enzymes like cytochrome oxidases or peroxidases.

  • Rescue experiments: Testing whether wild-type HRG-5 or specific mutants can rescue phenotypes in HRG-5 knockout worms.

  • Genetic interaction studies: Examining how HRG-5 mutations interact with mutations in other heme transport or metabolism genes.

A methodological approach would include:

  • Creating precise mutations using CRISPR/Cas9

  • Measuring growth on varying heme concentrations over multiple generations

  • Performing biochemical assays to assess heme-dependent functions

  • Using fluorescent markers to track subcellular heme distribution

What evolutionary insights can be gained from studying HRG-5 across species?

Evolutionary studies of HRG proteins reveal interesting patterns. While C. elegans has four paralogs (HRG-1, HRG-4, HRG-5, and HRG-6), mammals have only a single homolog that shares only about 20% sequence identity with the worm proteins . Despite this low sequence homology, the human and worm proteins are functional orthologs, suggesting the heme transport mechanism is evolutionarily ancient .

To study the evolution of HRG-5:

  • Perform phylogenetic analyses across diverse species

  • Compare conserved functional residues identified through mutagenesis studies

  • Test cross-species functional complementation

  • Examine gene duplication and divergence patterns

What controls are essential when assessing HRG-5 transport activity?

When designing experiments to assess HRG-5 transport activity, several critical controls should be included:

  • Negative controls:

    • Empty vector transformants

    • Expression of non-functional HRG-5 mutants (e.g., with mutations in predicted heme-binding residues)

    • Non-related membrane proteins of similar size and topology

  • Positive controls:

    • Well-characterized heme transporters (e.g., HRG-1, HRG-4)

    • Established variants with different transport efficiencies

  • Experimental validation controls:

    • Verification of protein expression levels (Western blot)

    • Confirmation of proper subcellular localization (immunofluorescence)

    • Multiple independent measurements of transport activity

For example, when assessing heme-dependent growth in yeast, experiments with other HRG proteins included vector-only controls and confirmed that the enhanced growth correlated with increased ferrireductase activity and elevated cytoplasmic heme (measured via CYC1::LacZ reporter) .

How can researchers distinguish between direct and indirect effects of HRG-5 on heme homeostasis?

Distinguishing direct heme transport by HRG-5 from indirect effects on heme homeostasis requires careful experimental design:

  • Direct binding assays:

    • Purified protein binding to heme or heme analogs

    • Surface plasmon resonance or isothermal titration calorimetry to measure binding kinetics

    • Spectroscopic analyses of heme-protein interactions

  • Transport-specific assays:

    • Reconstitution in proteoliposomes for direct transport measurements

    • Transport of heme analogs that can be directly tracked

    • Competition assays with known heme-binding molecules

  • Controls for indirect effects:

    • Measuring effects on expression of other heme transporters

    • Assessing changes in heme metabolism enzymes

    • Examining alterations in iron homeostasis that might impact heme availability

The mechanistic studies with HRG-1 and HRG-4 used multiple complementary approaches to confirm direct transport, including growth assays, enzyme activity measurements, and reporter gene expression in heme-synthesis defective yeast .

What are the best approaches for comparing functional efficiency between HRG-5 and other HRG family members?

To compare the functional efficiency of HRG-5 with other HRG family members, researchers should employ multiple complementary approaches:

  • Standardized expression systems:

    • Ensure comparable protein expression levels through quantitative Western blotting

    • Use the same promoters, tags, and expression conditions

    • Consider codon optimization for the expression system if necessary

  • Quantitative functional assays:

    • Growth rate measurements in heme-deficient yeast at varying heme concentrations

    • Dose-response curves to determine EC50 values for heme utilization

    • Enzyme activity assays (e.g., ferrireductase) as a readout of functional heme import

  • Direct transport measurements:

    • Uptake kinetics of labeled heme or heme analogs

    • Competition assays to determine relative affinities

For example, research with other HRG proteins demonstrated that CeHRG-4 and CeHRG-1 showed >10-fold and 5-fold increases in ferrireductase activity respectively, providing a quantitative comparison of their relative efficiencies .

How can structural biology approaches enhance our understanding of HRG-5?

Advanced structural biology techniques can provide crucial insights into HRG-5 function:

  • X-ray crystallography or cryo-EM:

    • Determination of high-resolution structures

    • Identification of heme binding pockets

    • Visualization of conformational changes during transport

  • NMR spectroscopy:

    • Dynamic studies of protein regions during heme binding and transport

    • Investigation of protein-protein interactions

    • Analysis of membrane integration

  • Molecular dynamics simulations:

    • Modeling of heme movement through the transport channel

    • Prediction of conformational changes during the transport cycle

    • Evaluation of the roles of specific amino acids

  • Cross-linking studies:

    • Identification of residues in proximity to heme

    • Determination of protein oligomerization states

    • Mapping of interaction surfaces with other proteins

These approaches could help determine whether HRG-5, like other HRG proteins, functions as a multimer, as previous studies showed that HRG-1-related proteins migrate as dimers and trimers on nondenaturing PAGE .

What bioinformatic tools can assist in identifying critical functional domains in HRG-5?

Several bioinformatic approaches can help identify critical functional domains in HRG-5:

  • Multiple sequence alignment tools (e.g., CLUSTAL, MUSCLE):

    • Identify conserved residues across HRG family members

    • Compare HRG-5 sequences across different species

    • Detect evolutionary conservation patterns

  • Membrane topology prediction (e.g., TMHMM, Phobius):

    • Predict transmembrane domains

    • Identify cytoplasmic and exoplasmic loops

    • Determine orientation in the membrane

  • Structural homology modeling:

    • Generate 3D models based on known structures of related proteins

    • Predict potential heme binding sites

    • Visualize the spatial arrangement of conserved residues

  • Functional motif identification:

    • Search for known heme-binding motifs

    • Identify potential regulatory sequences

    • Detect protein-protein interaction domains

Such bioinformatic analyses helped identify conserved residues in HRG-1 and HRG-4, including the histidine in TMD2 and the FARKY motif in the C-terminus, which were experimentally confirmed to be critical for function .

What is the current state of research on post-translational modifications of HRG-5?

While the search results do not specifically address post-translational modifications (PTMs) of HRG-5, this represents an important area for investigation. Researchers examining PTMs in HRG-5 should consider:

  • Identification methods:

    • Mass spectrometry-based proteomics to identify types and sites of modifications

    • Specific antibodies against common PTMs (phosphorylation, glycosylation, ubiquitination)

    • Chemical labeling techniques for PTM enrichment

  • Functional significance assessment:

    • Site-directed mutagenesis of modified residues

    • Pharmacological inhibition of modifying enzymes

    • Temporal correlation of modifications with transport activity

  • Regulatory mechanisms:

    • Changes in modification patterns in response to heme levels

    • Identification of enzymes responsible for PTMs

    • Signaling pathways that regulate HRG-5 modifications

The experimental approach should include comparison with other HRG family members to determine whether regulatory mechanisms are conserved across the family.

How might HRG-5 function be leveraged in biotechnological applications?

Understanding HRG-5 function could enable several biotechnological applications:

  • Heme sensor development:

    • Engineering HRG-5-based biosensors for detecting heme in biological samples

    • Creating fluorescent reporters linked to HRG-5 for monitoring heme levels in cells

    • Developing high-throughput screening systems for heme transport modulators

  • Optimized recombinant hemoproteins:

    • Co-expression of HRG-5 to improve heme incorporation in recombinant hemoproteins

    • Enhancement of hemoprotein production in industrial strains

    • Engineering organisms for improved heme acquisition from limited sources

  • Therapeutic applications:

    • Targeting parasites that rely on host heme for survival

    • Developing treatments for disorders of heme metabolism

    • Creating improved delivery systems for heme-based therapeutics

These applications would build on the understanding that HRG proteins function to import heme into cells, with potential implications for organisms that cannot synthesize their own heme, similar to C. elegans .

What are the implications of HRG-5 research for understanding parasitic organisms that rely on host heme?

Research on HRG-5 and related transporters has significant implications for understanding parasitic organisms:

  • Parasite survival mechanisms:

    • Many parasites cannot synthesize heme and must acquire it from their hosts

    • Understanding heme acquisition pathways could reveal new therapeutic targets

    • Comparative analysis with HRG-5 could identify parasite-specific features of heme transporters

  • Therapeutic target potential:

    • Selective inhibition of parasite heme transporters

    • Development of compounds that compete with heme for transporter binding

    • Creation of transporter-targeted drug delivery systems

  • Evolutionary adaptations:

    • Analysis of how parasites have evolved heme acquisition mechanisms

    • Comparison with free-living relatives to identify parasite-specific adaptations

    • Examination of host-parasite co-evolution in heme transport systems

The significance of understanding HRG protein function extends to human parasites, which rely on host heme for survival, potentially providing novel therapeutic insights .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.