Recombinant Hemolysin BL-binding component (hblA)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Hemolysin BL-binding Component (hblA)

The Recombinant Hemolysin BL-binding component, also known as hblA, is a crucial subunit of the Hemolysin BL (Hbl) toxin produced by Bacillus cereus. This toxin is responsible for causing diarrheal food poisoning and is composed of three main components: a binding component (B), and two lytic components (L1 and L2) . The hblA protein is specifically the binding component that facilitates the interaction of the toxin with target cell membranes.

Structure and Expression of hblA

The hblA protein is typically expressed in Escherichia coli (E. coli) for research purposes. It is a full-length protein with an amino acid sequence spanning from 32 to 375 residues. The recombinant form of hblA is often fused with an N-terminal His tag to facilitate purification and detection . The protein is available in a lyophilized powder form and has a purity of greater than 90% as determined by SDS-PAGE .

Function and Role in Hemolysin BL Toxin

The hblA component plays a pivotal role in the mechanism of action of the Hbl toxin. It is responsible for binding to the target cell surface, which is a crucial step for the subsequent pore formation and cytotoxic activity . Studies have shown that an excess of hblA enhances the velocity of pore formation, while an excess of the lytic components can hinder this process . The binding of hblA to the cell surface occurs rapidly, followed by the apposition of the L1 and L2 components .

Research Findings and Applications

Recent research has focused on understanding the complex formation and interactions between the different components of the Hbl toxin. Monoclonal antibodies (mAbs) have been developed to study the mode of action of Hbl, with some mAbs capable of neutralizing Hbl toxicity and others enhancing it by facilitating the binding of hblA to the cell surface . The recombinant hblA protein is used in various applications, including SDS-PAGE for protein analysis and in studies aimed at elucidating the toxin's mechanism of action .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. To request a specific tag type, please specify it in your order; we will prioritize its development.
Synonyms
hblA; Hemolysin BL-binding component; Enterotoxin 40 kDa subunit
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
32-375
Protein Length
Full Length of Mature Protein
Species
Bacillus cereus
Target Names
hblA
Target Protein Sequence
SEIEQTNNGDTALSANEAKMKETLQKAGLFAKSMNAYSYMLIKNPDVNFEGITINGYVDL PGRIVQDQKNARAHAVTWDTKVKKQLLDTLTGIVEYDTTFDNYYETMVEAINTGDGETLK EGITDLRGEIQQNQKYAQQLIEELTKLRDSIGHDVRAFGSNKELLQSILKNQGADVDADQ KRLEEVLGSVNYYKQLESDGFNVMKGAILGLPIIGGIIVGVARDNLGKLEPLLAELRQTV DYKVTLNRVVGVAYSNINEIDKALDDAINALTYMSTQWHDLDSQYSGVLGHIENAAQKAD QNKFKFLKPNLNAAKDSWKTLRTDAVTLKEGIKELKVETVTPQK
Uniprot No.

Target Background

Function

Recombinant Hemolysin BL-binding component (hblA): A cytotoxic protein, part of the enterotoxin complex, responsible for erythrocyte binding. This enterotoxin is implicated as the causative agent of diarrheal gastroenteritis from foodborne Bacillus cereus strains.

Subcellular Location
Secreted. Host cell membrane.

Q&A

What is the hblA gene and what is its role in the hemolysin BL complex?

The hblA gene encodes the binding component (B) of hemolysin BL, a tripartite enterotoxin produced by Bacillus cereus. This component is essential for the toxin's mechanism of action, as it mediates the initial attachment to target cells. The B component is expressed as a polypeptide of 41 kDa containing a signal peptide that allows for its secretion by B. cereus into the culture medium . Northern blot analysis has shown that hblA is part of a 5.1-kb transcript detected in early-log-phase cultures, suggesting that it may be found in an operon transcribed as a polycistronic message, possibly with genes encoding the other components of hemolysin BL .

How can researchers clone and express recombinant hblA protein?

Researchers can clone the hblA gene by constructing a partial genomic library and using oligonucleotide probes designed from the N-terminal amino acid sequence of the B component . The gene can then be expressed in Escherichia coli for further characterization. The cloning approach involves:

  • Constructing a genomic library from B. cereus DNA

  • Designing appropriate oligonucleotide probes based on known amino acid sequences

  • Screening the library for positive clones

  • Sequencing positive clones to confirm identity

  • Subcloning the hblA gene into an expression vector with an appropriate promoter

  • Transforming E. coli and inducing expression

  • Purifying the recombinant protein using chromatographic techniques

This approach enables production of large quantities of the purified protein for further characterization of hemolysin BL and for testing enterotoxic activity .

How can functional activity of recombinant hblA be validated?

The functional activity of cloned hblA (B component) can be validated by demonstrating that it causes hemolysis of sheep erythrocytes when combined with the L1 and L2 components of hemolysin BL . This can be visualized using a blood agar diffusion assay where the recombinant B component is added to central wells and the L components are added either individually or in combination to surrounding wells. Upon diffusion of the components through the blood agar gel, hemolysis is produced in areas between wells containing a combination of L1 and L2 and wells containing recombinant B, but not with control lysates lacking the insert .

What is the molecular mechanism of pore formation by hemolysin BL, and how does the B component contribute?

Hemolysin BL is a pore-forming toxin that acts through sequential binding of its components to target cell membranes. According to the current model, the three components bind to the target cell surface sequentially in the binding order B-L1-L2 . A defined concentration ratio is required for efficient pore formation, with optimal activity observed at ratios of Hbl L2:L1:B = 1:1:10 or 10:1:10 .

The B component initiates the pore formation process by binding to the cell surface. Complex formation between B monomers and between B and L1 in solution is essential for rapid pore formation. Studies have shown that complexation with L1 increases binding of B to the target cell surface . The resulting pore is moderately cation selective and relatively unstable compared to other pore-forming toxins .

This sequential binding model explains the characteristic ring-shaped discontinuous hemolysis pattern observed on blood agar plates, where hemolysis occurs at appropriate concentration ratios of the three components .

How does the newly discovered hblB gene product (Hbl B') interact with the canonical hemolysin BL components?

The hblB gene, located downstream of the hblCDA operon in many B. cereus strains, encodes the Hbl B' protein, which shares sequence homology with the B component encoded by hblA . Recent research has demonstrated that:

  • The hblB gene is expressed and the Hbl B' protein is secreted by nearly all analyzed B. cereus strains

  • When recombinant Hbl B' is applied simultaneously with L2, L1, and B components, a distinct reduction of cytotoxic and hemolytic activity is observed

  • This inhibitory effect is due to direct interaction of Hbl B' with the L1 component

These findings suggest that Hbl B' plays an important regulatory function in the mechanism of Hbl, which can be described as an additional control of complex formation that balances the amounts of Hbl B-L1 complexes and the corresponding free subunits .

What structural features of recombinant hblA affect its function and how can they be analyzed?

The structural features of the B component are crucial for understanding its function in the hemolysin BL complex. The B component shows structural similarity to hemolysin E (HlyE; ClyA) from E. coli, which forms pores in target cell membranes by homo-oligomerization . Key structural considerations include:

  • Signal peptide region: The B component contains a signal peptide that facilitates secretion

  • Binding domains: Regions involved in target cell recognition and attachment

  • Oligomerization domains: Areas that mediate interaction with other B monomers

  • Interaction interfaces: Surfaces that interact with L1 and L2 components

To analyze these structural features, researchers can employ:

  • X-ray crystallography or cryo-EM to determine three-dimensional structure

  • Site-directed mutagenesis to identify critical residues

  • Protein-protein interaction assays to map binding interfaces

  • Fluorescence microscopy to track localization on target cells

What are the optimal conditions for producing high-quality recombinant hblA protein for structural and functional studies?

Table 1: Optimization Parameters for Recombinant hblA Production

ParameterConditionEffectConsiderations
Expression SystemE. coli BL21(DE3)High yield, simple cultivationMay require signal peptide modification
Expression VectorpASK-IBA5plusN-terminal strep-tag for purificationTag may affect protein folding
InductionIPTG, 0.1-1.0 mMControls expression levelHigher concentrations may lead to inclusion bodies
Growth Temperature16-30°CAffects folding and solubilityLower temperatures favor proper folding
Growth MediumLB or TBNutrient availabilityTB provides higher cell density
Harvest TimeOD600 = 0.6-0.8Optimal cell densityLater harvest may increase yield but decrease quality
PurificationAffinity chromatographyHigh purityAdditional steps may be needed for highest purity

When producing recombinant hblA protein, researchers should consider that the native protein is expressed as a 41 kDa polypeptide containing a signal peptide that allows for secretion . For optimal expression in E. coli, the signal peptide may need to be modified or removed. Additionally, expression level and protein solubility can be improved by optimizing temperature, inducer concentration, and growth medium composition.

How can researchers investigate the interaction between hblA-encoded protein and other components of the hemolysin BL complex?

To investigate the interactions between the B component and other components of hemolysin BL (L1 and L2), researchers can employ several complementary approaches:

  • Co-immunoprecipitation assays: Using antibodies specific to one component to pull down interacting partners

  • Surface plasmon resonance (SPR): To determine binding kinetics and affinity constants

  • Förster resonance energy transfer (FRET): To visualize interactions in real-time

  • Yeast two-hybrid or bacterial two-hybrid systems: To map interaction domains

  • Crosslinking studies: To capture transient interactions

  • Analytical ultracentrifugation: To characterize complex formation

Recent studies have shown that complex formation between B monomers, between B and L1, and between L2 and L1 is essential for rapid pore formation . Specifically, complexation with L1 increases binding of B to the target cell surface . These interactions can be studied using purified recombinant components, which allows for precise control over concentration ratios and experimental conditions.

What experimental approaches can be used to study the role of hblA in bacterial pathogenesis?

Researchers investigating the role of hblA in bacterial pathogenesis can utilize several experimental approaches:

  • Gene knockout studies: Creating hblA deletion mutants in B. cereus and assessing changes in virulence

  • Complementation experiments: Restoring hblA function in knockout strains to confirm phenotype

  • Animal models: Using rabbit ileal loop assays to measure fluid accumulation, which is comparable to cholera toxin-induced effects

  • Cell culture models: Assessing cytotoxicity to various cell lines as hemolysin BL has been shown to be cytotoxic to multiple cell types

  • Hemolysis assays: Quantifying hemolytic activity against erythrocytes from different species

  • Vascular permeability tests: Measuring increased permeability induced by the toxin

  • Transcriptomics: Analyzing expression patterns of hblA under different conditions

These approaches can help elucidate how the B component contributes to the enterotoxic effects of B. cereus and potentially identify targets for therapeutic intervention.

How can researchers differentiate between the functions of hblA and hblB gene products in experimental settings?

Differentiating between the functions of hblA (B component) and hblB (B' component) requires careful experimental design:

  • Specific detection systems: Develop monoclonal antibodies that specifically recognize either B or B' protein. For example, monoclonal antibody 11A5 has been developed for specific detection of Hbl B'

  • Genetic manipulation: Create single and double knockout mutants (ΔhblA, ΔhblB, and ΔhblA/ΔhblB) to assess individual and combined effects

  • Recombinant protein studies: Express and purify both proteins separately and assess their individual activities and their effects when combined with other components

  • Competitive binding assays: Determine if B and B' compete for the same binding sites on target cells or on other Hbl components

  • Structural comparison: Analyze structural differences that might explain functional divergence, noting that B' emerged from duplication of hblA and a C-terminal fusion with another open reading frame

Recent research has demonstrated that while B is essential for the toxin's activity, B' appears to have a regulatory function, reducing cytotoxic and hemolytic activity when applied simultaneously with L2, L1, and B components due to direct interaction with L1 .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.