Recombinant Salmonella typhi Hemolysin E (hlyE)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
hlyE; clyA; sheA; STY1498; t1477; Hemolysin E; Cytotoxin ClyA; Silent hemolysin SheA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-303
Protein Length
Full Length of Mature Protein
Species
Salmonella typhi
Target Names
hlyE
Target Protein Sequence
TGIFAEQTVEVVKSAIETADGALDLYNKYLDQVIPWKTFDETIKELSRFKQEYSQEASVL VGDIKVLLMDSQDKYFEATQTVYEWCGVVTQLLSAYILLFDEYNEKKASAQKDILIRILD DGVKKLNEAQKSLLTSSQSFNNASGKLLALDSQLTNDFSEKSSYFQSQVDRIRKEAYAGA AAGIVAGPFGLIISYSIAAGVIEGKLIPELNNRLKTVQNFFTSLSATVKQANKDIDAAKL KLATEIAAIGEIKTETETTRFYVDYDDLMLSLLKGAAKKMINTCNEYQQRHGKKTLFEVP DV
Uniprot No.

Target Background

Function

Hemolysin E (HlyE) from Salmonella typhi exhibits hemolytic activity against mammalian cells. Its mechanism of action involves the formation of pore-like structures upon cell membrane interaction.

Database Links

KEGG: stt:t1477

STRING: 220341.STY1498

Protein Families
Hemolysin E family
Subcellular Location
Secreted. Periplasm. Host cell membrane; Single-pass membrane protein.

Q&A

What is Salmonella typhi Hemolysin E (HlyE) and why is it significant for research?

Salmonella typhi Hemolysin E (HlyE) is a pore-forming cytotoxic protein with hemolytic activity that functions as an essential virulence factor in Salmonella enterica serovar Typhi. The protein is approximately 34 kDa in size and is encoded by the hlyE gene, which is also known as clyA or sheA. HlyE is particularly significant in research because it is specifically expressed in typhoidal Salmonella strains (S. Typhi and S. Paratyphi A) but absent or minimally expressed in non-typhoidal Salmonella serovars like S. Typhimurium. This specificity makes HlyE valuable for diagnostic applications, virulence studies, and vaccine development targeting typhoid fever, which affects an estimated 22 million people globally with approximately 200,000 related deaths annually .

How does HlyE contribute to S. Typhi pathogenesis?

HlyE functions as a critical virulence factor through several mechanisms:

  • Pore formation: HlyE forms large, stable pores in target cell membranes upon contact with mammalian cells, disrupting membrane integrity

  • Macrophage survival: The protein is required for bacterial survival within host macrophages, a key step in S. Typhi pathogenesis

  • Hemolytic activity: HlyE causes hemolysis of erythrocytes, contributing to bacterial dissemination

  • Apoptogenic effects: The protein induces apoptosis in human and murine monocytes/macrophages, potentially hampering immune responses

Research has confirmed that S. Typhi and S. Paratyphi A strains produce substantial amounts of HlyE during human infection, with the protein detectable in the plasma of patients with S. Typhi bacteremia . This expression pattern supports its role as a critical factor in the development of typhoid fever symptoms and pathology.

What are the established methods for producing recombinant S. Typhi HlyE?

Production of recombinant HlyE typically follows this methodological approach:

  • Gene amplification: PCR-amplify the hlyE gene from S. Typhi genomic DNA (common sources include Ty21a strain)

  • Cloning: Insert the amplified sequence into an expression vector such as pET21a

  • Expression system: Transform the construct into an appropriate E. coli expression strain, preferably using LPS-modified strains like ClearCoil BL21 cells to produce endotoxin-free proteins

  • Induction and expression: Induce protein expression using standard IPTG induction protocols

  • Purification: Employ nickel-affinity chromatography (HisTrap columns) for His-tagged proteins, followed by desalting on appropriate columns (e.g., HiPrep 26/10)

  • Quality control: Verify protein purity (>95% purity is standard) using SDS-PAGE and western blotting

  • Formulation: Lyophilize in appropriate buffer (commonly 20mM Na-carbonate Buffer, pH10)

This approach yields recombinant His-tagged HlyE protein suitable for immunological and biochemical studies with minimal endotoxin contamination, which is critical for immunological applications.

What analytical methods are most effective for characterizing recombinant HlyE?

Comprehensive characterization of recombinant HlyE requires multiple analytical approaches:

Analytical MethodApplicationKey Parameters
SDS-PAGEPurity assessmentExpected size: ~34 kDa with His-tag
Western BlotIdentity confirmationAnti-His antibodies or HlyE-specific antibodies
Circular DichroismSecondary structure analysisAlpha-helical content evaluation
Mass SpectrometryMolecular weight confirmation, PTM analysisExpected mass: ~34 kDa
Dynamic Light ScatteringOligomerization state assessmentMonomer vs. multimeric forms
Hemolytic Activity AssayFunctional characterizationEC50 of hemolytic activity
LPS Contamination AssayEndotoxin detectionLimulus Amebocyte Lysate test

For functional validation, particularly when using HlyE for immunological studies, it's essential to confirm that the recombinant protein maintains its native antigenic properties by testing reactivity with sera from confirmed typhoid patients compared to control subjects .

How can recombinant HlyE be optimized for typhoid fever serodiagnosis?

Optimizing HlyE-based serodiagnostic assays involves several methodological considerations:

  • Antigen preparation: Use highly purified (>95%) recombinant HlyE in both native and denatured forms, as both have been shown to be antigenic

  • Antibody isotype targeting: Design assays to detect multiple antibody isotypes (IgG, IgA, and IgM) as they provide complementary diagnostic information about infection stage

  • Assay format optimization: Implement indirect antibody immunoassays (ELISA) with optimized antigen coating concentration (nanogram amounts of HlyE have been shown to be sufficient)

  • Cut-off determination: Establish appropriate cut-off values using ROC curve analysis of confirmed typhoid and non-typhoid control sera

  • Validation: Test with a sufficient sample size (n≥100) of well-characterized patient and control sera to establish sensitivity and specificity

What advantages do HlyE-based diagnostic methods offer over traditional typhoid diagnostics?

HlyE-based diagnostics provide several advantages compared to traditional methods:

  • Specificity: HlyE is specifically expressed by typhoidal Salmonella (S. Typhi and S. Paratyphi A) but not by non-typhoidal Salmonella strains, allowing for discrimination between typhoid fever and other Salmonella infections

  • Multi-isotype detection: HlyE can detect multiple antibody isotypes (IgG, IgA, and IgM), providing information about different stages of infection

  • High throughput: ELISA formats allow for processing of multiple samples simultaneously

  • Resource efficiency: Nanogram amounts of HlyE are sufficient for detection, making the assay economical

  • Point-of-care potential: The specific binding characteristics of HlyE make it suitable for incorporation into rapid diagnostic tests and lateral flow assays

  • Perfect specificity: Studies have demonstrated 100% specificity (44/44 non-typhoid samples correctly identified)

These advantages make HlyE particularly valuable in endemic settings where the differentiation of typhoid from other febrile illnesses and the processing of large numbers of samples are critical challenges.

How can B-cell epitopes of S. Typhi HlyE be identified and characterized?

Comprehensive epitope mapping of HlyE involves a multi-step approach:

  • Peptide library screening: Generate a random 20-mer peptide library displayed on phage and perform biopanning using anti-HlyE polyclonal antibodies enriched from typhoid patient sera

  • Sequence analysis: Analyze enriched peptide sequences to identify potential epitopes, filtering out target unrelated peptides (TUPs)

  • Epitope prediction: Use bioinformatic tools to refine and map the enriched peptide sequences against the HlyE protein structure

  • Epitope classification: Distinguish between linear epitopes (continuous amino acid sequences) and conformational epitopes (formed by non-contiguous amino acids in folded protein)

  • Validation: Confirm predicted epitopes by testing their reactivity with pooled typhoid patient sera

  • Monoclonal antibody development: Generate epitope-specific monoclonal antibodies using antibody phage display techniques

  • Structural analysis: Perform molecular docking to understand the interaction between antibodies and epitopes on both monomeric and oligomeric HlyE structures

This approach has successfully identified both linear epitopes (e.g., GAAAGIVAG) and conformational epitopes (e.g., PYSQESVLSADSQNQK) on the HlyE protein, providing valuable information for diagnostic and therapeutic antibody development .

What methodologies are most effective for developing high-affinity aptamers against HlyE?

The development of DNA aptamers against HlyE can be achieved through this systematic approach:

  • SELEX implementation: Utilize systematic evolution of ligands by exponential enrichment (SELEX) with a random DNA library to isolate aptamers that specifically bind to HlyE

  • Binding assessment: Evaluate binding affinity and specificity using enzyme-linked oligonucleotide assay (ELONA)

  • Aptamer selection: Identify distinct aptamer sequences based on clustering analysis of enriched sequences

  • Affinity determination: Calculate dissociation constants (Kd) for the most promising aptamers, targeting nanomolar range affinities

  • Specificity testing: Assess cross-reactivity against other bacterial proteins, particularly from related pathogens such as S. Paratyphi A/B, Shigella flexneri, Klebsiella pneumoniae, and Escherichia coli

Using this methodology, researchers have successfully developed aptamers with high affinity (e.g., AptHlyE97 with Kd of 83.6 nM) and excellent specificity for S. Typhi HlyE compared to proteins from other bacterial species . These aptamers have significant potential for developing inexpensive point-of-care diagnostic tests for typhoid surveillance, particularly in resource-limited settings.

How can HlyE be utilized to study the human immune response to S. Typhi infection?

HlyE provides a valuable tool for investigating multiple aspects of the human immune response to S. Typhi:

  • Antibody isotype profiling: Measure multi-isotype (IgG, IgA, IgM) antibody responses against HlyE in sera from typhoid patients to characterize the humoral immune response progression

  • Antibody-secreting cell (ASC) responses: Quantify HlyE-specific ASCs using ELISpot assays to evaluate the cellular basis of antibody production during infection and following vaccination

  • Bactericidal activity assessment: Evaluate the relationship between anti-HlyE antibodies and serum bactericidal activity against S. Typhi to understand protective mechanisms

  • T-cell response characterization: Assess HlyE-specific T-cell responses to understand the cellular immune response components

  • Epitope-specific responses: Analyze antibody responses to specific HlyE epitopes to identify immunodominant regions that could be targeted in vaccine development

Research using these approaches has revealed that while anti-HlyE antibodies contribute to the immune response, anti-O:LPS antibodies appear to be the primary mediators of bactericidal activity that reduces clinical symptoms but does not provide complete protection against infection .

What is the relationship between anti-HlyE antibodies and protection against typhoid fever?

The relationship between anti-HlyE antibodies and protection against typhoid fever is complex:

  • Bactericidal activity: Studies suggest that while HlyE is highly immunogenic, anti-HlyE antibodies may not be the primary mediators of bactericidal activity, which appears to be predominantly associated with anti-O:LPS antibodies

  • Clinical symptoms modulation: Bactericidal antibodies, including those that may target HlyE, have been shown to significantly reduce clinical symptoms, lower bacterial burden, and decrease disease severity scores in challenge studies

  • Incomplete protection: Despite inducing antibody responses, these antibodies do not provide sterile immunity against S. Typhi infection

  • Diagnostic vs. protective role: HlyE appears to be more valuable as a diagnostic antigen than as a protective antigen, as it effectively discriminates between typhoid patients and control subjects

Research using controlled human infection models has shown that while vaccination with typhoid vaccines (like Ty21a or M01ZH09) induces antibody responses, including potential responses to HlyE, the protection is incomplete . This suggests that effective vaccines may need to target multiple antigens or additional protective mechanisms beyond antibody-mediated immunity.

What methodologies can be employed to study the pore-forming mechanism of HlyE?

Investigating HlyE's pore-forming mechanism requires multiple complementary approaches:

  • Structural analysis:

    • X-ray crystallography or cryo-electron microscopy to determine the structure of monomeric and oligomeric HlyE

    • Homology modeling based on related proteins (e.g., E. coli HlyE/ClyA) when crystal structures are unavailable

  • Membrane interaction studies:

    • Liposome leakage assays to measure pore formation kinetics

    • Surface plasmon resonance to quantify binding to membrane components

    • Atomic force microscopy to visualize pore formation in real-time

  • Functional characterization:

    • Hemolysis assays using erythrocytes to measure pore-forming activity

    • Cytotoxicity assays with macrophage cell lines to quantify apoptogenic effects

    • Patch-clamp electrophysiology to characterize pore conductance properties

  • Mutational analysis:

    • Site-directed mutagenesis of key residues to identify those critical for pore formation

    • Structure-function correlation of mutant phenotypes

These methodologies have revealed that HlyE forms large, stable pores in target membranes upon contact with mammalian cells, leading to membrane disruption and ultimately cell death through mechanisms that include apoptosis induction in monocytes/macrophages .

How do conformational changes affect HlyE function and immunogenicity?

HlyE undergoes significant conformational changes that impact both its function and immunological properties:

  • Functional implications:

    • Transition from soluble monomer to membrane-associated oligomer is essential for pore formation

    • Conformational changes expose hydrophobic regions that facilitate membrane insertion

    • Oligomerization creates the functional pore structure

  • Immunological significance:

    • Both native (conformational) and denatured (linear) forms of HlyE are antigenic

    • Conformational epitopes such as PYSQESVLSADSQNQK are recognized by typhoid patient antibodies

    • Linear epitopes like GAAAGIVAG are also immunologically relevant

    • Antibodies targeting different conformational states may have different functional effects

  • Diagnostic relevance:

    • The antigenicity of both native and denatured forms makes HlyE versatile for diagnostic applications

    • ELISA formats can be optimized to detect antibodies against both conformational states

Understanding these conformational dynamics is critical for both diagnostic applications and potential therapeutic strategies targeting HlyE function during infection.

How can HlyE contribute to novel typhoid vaccine development strategies?

HlyE offers several promising avenues for typhoid vaccine development:

  • Subunit vaccine component:

    • Recombinant HlyE could be incorporated into subunit vaccines alongside other immunogenic S. Typhi proteins

    • Both linear and conformational epitopes could be targeted to induce comprehensive immune responses

  • Diagnostic marker for vaccine efficacy:

    • Monitoring anti-HlyE antibody responses can serve as one biomarker for vaccine immunogenicity

    • Changes in anti-HlyE IgG, IgA, and IgM levels could indicate successful vaccine take

  • Reverse vaccinology approach:

    • Epitope mapping of HlyE can identify immunodominant regions for targeted vaccine design

    • Monoclonal antibodies against these epitopes can guide vaccine formulation

  • Combination with other antigens:

    • Research indicates that while HlyE is immunogenic, effective protection may require combination with additional antigens, particularly those that induce anti-O:LPS antibodies

    • Multi-antigen formulations could provide more comprehensive protection

While HlyE alone may not confer complete protection, its well-defined immunogenicity and typhoid-specific expression pattern make it a valuable component in next-generation vaccine development strategies.

What are the challenges in using HlyE for typhoid vaccine development?

Several challenges must be addressed when considering HlyE for vaccine applications:

  • Incomplete protection:

    • Studies suggest that antibodies induced after vaccination, including potential anti-HlyE responses, significantly reduce clinical symptoms but do not provide sterile immunity

    • Anti-O:LPS antibodies appear to be more critical for bactericidal activity than anti-HlyE antibodies

  • Conformational considerations:

    • Maintaining the proper conformation of HlyE epitopes in vaccine formulations may be challenging

    • Both linear and conformational epitopes should be considered for comprehensive immunity

  • Safety concerns:

    • As a pore-forming toxin with cytolytic activity, safety considerations are paramount

    • Detoxified versions or specific epitopes may be preferable to whole protein

  • Adjuvant requirements:

    • Determining optimal adjuvants for HlyE-based vaccines to enhance immunogenicity while maintaining safety

    • Balancing Th1/Th2 responses for effective protection

  • Evaluation methods:

    • Developing appropriate assays to evaluate vaccine efficacy beyond antibody titers

    • Controlled human infection models may be necessary to assess protective efficacy

Addressing these challenges through systematic research is essential for leveraging HlyE's potential in future typhoid vaccine development efforts.

What emerging technologies could enhance HlyE research and applications?

Several cutting-edge technologies hold promise for advancing HlyE research:

  • Single-cell antibody profiling:

    • Analysis of B-cell receptor repertoires from typhoid patients to identify naturally occurring anti-HlyE antibodies

    • Characterization of affinity maturation pathways during infection

  • Advanced structural biology techniques:

    • Cryo-electron microscopy to resolve the structure of HlyE pore complexes in membranes

    • Hydrogen-deuterium exchange mass spectrometry to map conformational changes during pore formation

  • CRISPR-based approaches:

    • Gene editing to create precise mutations in HlyE for structure-function studies

    • Development of CRISPR diagnostics (SHERLOCK, DETECTR) utilizing HlyE-specific aptamers

  • Microfluidic immunoassays:

    • Development of integrated systems for rapid, sensitive detection of anti-HlyE antibodies

    • Point-of-care diagnostics suitable for limited-resource settings

  • Computational approaches:

    • Machine learning algorithms to predict protective epitopes

    • Molecular dynamics simulations of HlyE-membrane interactions

These technologies could significantly accelerate both basic research on HlyE function and translational applications in diagnostics and vaccine development.

What are the critical unresolved questions in HlyE research?

Despite significant progress, several important questions about HlyE remain unanswered:

  • Structural determinants of specificity:

    • What structural features distinguish S. Typhi HlyE from homologs in other bacteria?

    • How does HlyE specifically recognize target cell membranes?

  • Regulation mechanisms:

    • How is HlyE expression regulated during different stages of S. Typhi infection?

    • What environmental signals trigger HlyE production in vivo?

  • Immunological questions:

    • Why do anti-HlyE antibodies not confer sterile protection despite their specificity?

    • What T-cell responses are elicited by HlyE, and how do they contribute to immunity?

  • Clinical correlations:

    • How do anti-HlyE antibody levels correlate with disease severity and outcome?

    • Can anti-HlyE antibody profiles predict chronic carriage of S. Typhi?

  • Therapeutic potential:

    • Could monoclonal antibodies targeting specific HlyE epitopes serve as therapeutic agents?

    • How might anti-HlyE antibodies synergize with antibiotics for enhanced treatment?

Addressing these questions through rigorous research will be essential for fully understanding HlyE's role in S. Typhi pathogenesis and leveraging this knowledge for improved typhoid fever management.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.