Recombinant Hendra virus Glycoprotein G (G)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Note: While the tag type is determined during production, please inform us of any specific tag requirements for preferential development.
Synonyms
G; Glycoprotein G
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-604
Protein Length
full length protein
Species
Hendra virus (isolate Horse/Autralia/Hendra/1994)
Target Names
G
Target Protein Sequence
MMADSKLVSLNNNLSGKIKDQGKVIKNYYGTMDIKKINDGLLDSKILGAFNTVIALLGSI IIIVMNIMIIQNYTRTTDNQALIKESLQSVQQQIKALTDKIGTEIGPKVSLIDTSSTITI PANIGLLGSKISQSTSSINENVNDKCKFTLPPLKIHECNISCPNPLPFREYRPISQGVSD LVGLPNQICLQKTTSTILKPRLISYTLPINTREGVCITDPLLAVDNGFFAYSHLEKIGSC TRGIAKQRIIGVGEVLDRGDKVPSMFMTNVWTPPNPSTIHHCSSTYHEDFYYTLCAVSHV GDPILNSTSWTESLSLIRLAVRPKSDSGDYNQKYIAITKVERGKYDKVMPYGPSGIKQGD TLYFPAVGFLPRTEFQYNDSNCPIIHCKYSKAENCRLSMGVNSKSHYILRSGLLKYNLSL GGDIILQFIEIADNRLTIGSPSKIYNSLGQPVFYQASYSWDTMIKLGDVDTVDPLRVQWR NNSVISRPGQSQCPRFNVCPEVCWEGTYNDAFLIDRLNWVSAGVYLNSNQTAENPVFAVF KDNEILYQVPLAEDDTNAQKTITDCFLLENVIWCISLVEIYDTGDSVIRPKLFAVKIPAQ CSES
Uniprot No.

Target Background

Function
Hendra virus glycoprotein G (G) mediates viral attachment to host cells via binding to sialic acid-containing cell receptors, initiating infection. This receptor binding induces a conformational change in G, triggering fusion of the viral and cellular membranes by the F protein.
Gene References Into Functions
  1. Crystal structure of Hendra virus attachment G glycoprotein bound to a potent cross-reactive neutralizing human monoclonal antibody. PMID: 24130486
  2. Dimer assembly of Hendra virus G protein is conserved among paramyxoviruses. PMID: 20375167
  3. Soluble G specifically binds to Hendra virus infection-permissive cells, but not non-permissive HeLa cells, indicating binding to a host cell receptor. PMID: 15890907
  4. Conformation-dependent receptor binding elements are located within the predicted globular-head region of the Hendra virus G envelope glycoprotein. PMID: 17376907
  5. The stalk domain of G plays a crucial role in conformational stability and receptor-binding-induced changes leading to membrane fusion, including G and F dissociation. PMID: 18799571
Database Links

KEGG: vg:1446471

Protein Families
Paramyxoviruses hemagglutinin-neuraminidase family
Subcellular Location
Virion membrane; Single-pass type II membrane protein. Host cell membrane; Single-pass type II membrane protein.

Q&A

What is the structure and function of Hendra virus Glycoprotein G?

Hendra virus Glycoprotein G (HeV-G) is a critical attachment protein that mediates viral entry into host cells. Structurally, it is a type I transmembrane glycoprotein with a calculated molecular weight of approximately 61.5 kDa, though it typically migrates as 80-100 kDa on SDS-PAGE due to extensive glycosylation . The protein consists of an ectodomain (amino acids 73-604), a transmembrane domain, and a cytoplasmic tail . Functionally, HeV-G serves as the attachment protein that binds to host cell receptors, facilitating the initial step in the viral infection process . Crystal structure analysis has revealed important epitopes that are targeted by neutralizing antibodies, providing critical insights for vaccine development and therapeutic strategies .

How is recombinant Hendra virus Glycoprotein G typically produced for research purposes?

Recombinant Hendra virus Glycoprotein G is commonly produced using mammalian expression systems, particularly HEK293 cells, to ensure proper glycosylation and folding . The production typically involves:

  • Cloning the HeV-G gene sequence (NCBI Accession Number: AEQ38026.1 or similar) into appropriate expression vectors

  • Expressing the protein as a fusion construct (e.g., with sheep IgG Fc tag or polyhistidine tag) to facilitate purification

  • Purifying the expressed protein using affinity chromatography

  • If necessary, removing fusion tags through proteolytic cleavage

  • Further purification and characterization using size exclusion chromatography and other analytical methods

The resulting protein is often supplied as a lyophilized product in stabilizing buffers containing components like trehalose, PBS, and arginine . For soluble forms (sGHeV), researchers typically use constructs that exclude the transmembrane and cytoplasmic tail domains to improve solubility and expression yields .

What animal models have been validated for studying Hendra virus vaccines based on Glycoprotein G?

Multiple animal models have been validated for studying Hendra virus vaccines based on Glycoprotein G, with each model offering distinct advantages for specific research questions:

Animal ModelKey CharacteristicsVaccine Formulation TestedProtection LevelCitation
FerretsClosely mirrors disease seen in humans and horses with systemic vasculitisHeVsG with CpG adjuvant (4-100 μg doses)Complete protection; no virus detection in 20-100 μg groups
African Green Monkeys (AGMs)Nonhuman primate model that faithfully recapitulates human HeV infectionsGHeV with Alhydrogel or sGHeV with Alhydrogel and CpGComplete protection in all vaccinated animals
HorsesNatural host with relevant transmission potential to humansHeVsGEffective protection; licensed for veterinary use in Australia

The ferret model demonstrates particular utility for studying transmission dynamics, as the research showed that properly vaccinated animals not only survived challenge but showed no evidence of viral shedding that could lead to transmission . The AGM model provides critical data for human vaccine development, while equine studies have already translated to a commercial vaccine (Equivac HeV) .

What are the critical immunological considerations when developing a subunit vaccine based on HeV-G?

Developing an effective subunit vaccine based on HeV-G requires careful attention to several critical immunological factors:

  • Antigen Design and Conformation: The recombinant HeV-G must maintain native conformational epitopes to elicit neutralizing antibodies. Studies have shown that using the soluble ectodomain (amino acids 73-604) with removal of transmembrane and cytoplasmic domains creates an effective immunogen that retains critical epitopes . This engineering approach produces sGHeV (soluble G) that has proven effective in multiple animal models.

  • Adjuvant Selection: Research demonstrates significant differences in vaccine efficacy based on adjuvant formulations. Comparative studies have shown that while Alhydrogel alone provides protection, the addition of CpG adjuvant can enhance immune responses . This combination appears to stimulate both humoral and cell-mediated immunity, which may be crucial for complete protection.

  • Cross-Protective Potential: HeV-G shares significant structural homology with Nipah virus G protein, allowing for cross-protection potential. Evidence shows that HeV-G-based vaccines can protect against Nipah virus challenge in animal models, suggesting broader henipavirus protection . This cross-protective property makes HeV-G particularly valuable for vaccine development against multiple high-consequence pathogens.

  • Neutralizing Antibody Responses: The primary correlate of protection appears to be neutralizing antibodies targeting specific epitopes on HeV-G. The crystal structure analysis of HeV-G in complex with neutralizing antibodies like m102.4 has identified critical binding sites that should be preserved in vaccine design .

  • Dose-Response Relationship: Studies in ferrets have established a clear dose-response relationship, with complete protection (including prevention of viral shedding) at 20-100 μg doses, while lower doses (4 μg) may allow some limited viral replication in the upper respiratory tract . This information is critical for establishing minimum protective doses in clinical development.

How do researchers evaluate the effectiveness of neutralizing antibodies against HeV-G and what are the key escape mechanisms?

Researchers evaluate neutralizing antibodies against HeV-G through multiple complementary approaches:

  • Binding Assays: Techniques like BioLayer Interferometry are used to determine binding kinetics and affinities of antibodies to recombinant HeV-G proteins. Comparative analysis of different antibodies, such as the m102 derivatives (m102.3 and m102.4), has revealed subtle differences in binding profiles that correlate with neutralization potency .

  • Pseudovirus Neutralization: Using HeV pseudotyped viruses to assess neutralization capacity under BSL-2 conditions, allowing for higher-throughput screening of antibody candidates.

  • Live Virus Neutralization: Testing antibody neutralization against infectious HeV under BSL-4 conditions, which represents the gold standard for antibody evaluation.

  • Epitope Mapping: X-ray crystallography of HeV-G in complex with antibodies like m102.4 has identified specific binding epitopes and mechanisms of neutralization . This structural information helps predict potential escape mutations.

  • Escape Mutant Generation and Characterization: Researchers have identified and characterized escape mutants generated under antibody pressure. These studies have revealed specific mutations that allow the virus to evade neutralization .

The key escape mechanisms identified include:

  • Mutations in specific residues within the receptor-binding domain that disrupt antibody binding while maintaining receptor affinity

  • Glycosylation changes that shield critical epitopes from antibody recognition

  • Conformational changes in the G protein that alter epitope presentation

Understanding these escape mechanisms is crucial for developing antibody cocktails or vaccine designs that target multiple epitopes, reducing the risk of escape mutant emergence during treatment or prevention strategies.

What methodological approaches are used to study HeV-G interactions with host cell receptors, and how do these inform therapeutic development?

The study of HeV-G interactions with host cell receptors employs several sophisticated methodological approaches that provide crucial insights for therapeutic development:

  • Receptor Identification and Characterization:

    • Protein interaction assays using soluble HeV-G and cell membrane preparations

    • Genetic screening approaches to identify susceptible and resistant cell lines

    • Immunoprecipitation and mass spectrometry to identify binding partners

    • These methods have identified ephrin-B2 and ephrin-B3 as the primary cellular receptors for HeV-G

  • Structural Analysis of Receptor-Ligand Interactions:

    • X-ray crystallography of HeV-G in complex with ephrin receptors

    • Cryo-electron microscopy to visualize larger complexes

    • Molecular dynamics simulations to understand binding energetics and conformational changes

    • These approaches have revealed the precise binding interface and critical residues involved in receptor recognition

  • Binding Kinetics and Affinity Measurements:

    • Surface plasmon resonance and BioLayer Interferometry to determine binding constants

    • Cell-based binding assays using flow cytometry

    • Competition assays to map binding sites

    • These studies have quantified the high-affinity interactions between HeV-G and ephrins

  • Functional Assays for Entry Inhibition:

    • Cell-cell fusion assays to measure HeV-G and F protein-mediated membrane fusion

    • Pseudovirus entry assays to quantify viral entry in controlled settings

    • Live virus infection assays under BSL-4 conditions

    • These methods have been instrumental in screening potential entry inhibitors

These methodological approaches have directly informed therapeutic development in several ways:

  • The development of soluble ephrin decoys that compete for virus binding

  • The design of receptor-blocking antibodies like m102.4 that prevent attachment to cell receptors

  • Structure-based design of small molecule inhibitors targeting the receptor-binding site

  • Identification of post-attachment inhibitors that block fusion after receptor binding

The m102.4 antibody, which was developed based on these approaches, has shown significant promise as a post-exposure therapeutic and has been used in humans on a compassionate use basis . This antibody specifically blocks the interaction between HeV-G and its cellular receptors, preventing viral entry and subsequent infection.

What are the optimal conditions for expressing and purifying functional recombinant HeV-G for structural and functional studies?

Optimal expression and purification of functional recombinant HeV-G requires careful consideration of several parameters:

Expression System Selection:

  • Mammalian cell expression (particularly HEK293 cells) is preferred over bacterial or insect cell systems due to the requirement for complex glycosylation that influences proper folding and function

  • Stable cell lines generally yield more consistent glycosylation patterns than transient expression systems

Construct Design Considerations:

  • For soluble HeV-G (sGHeV): Remove transmembrane domain and cytoplasmic tail (typically amino acids 73-604)

  • Inclusion of N-terminal signal peptide for secretion

  • Strategic placement of affinity tags (His-tag or Fc-fusion) that minimally impact structure and function

  • Codon optimization for the expression host

Expression Conditions:

  • Temperature: 32-37°C, with some protocols employing temperature shifts to 30°C after induction

  • Media supplements: Addition of glycosylation enhancers like sodium butyrate (1-5 mM)

  • Serum concentration: Typically reduced serum (1-2%) or serum-free conditions for cleaner purification

  • Culture duration: Extended culture periods (7-14 days) for secreted constructs to maximize yield

Purification Protocol:

  • Initial capture: Affinity chromatography using Ni-NTA (for His-tagged proteins) or Protein A/G (for Fc-fusion constructs)

  • Tag removal: Site-specific protease cleavage (if tags interfere with function)

  • Polishing: Size exclusion chromatography to achieve >95% purity and remove aggregates

  • Final formulation: Stabilization in buffers containing:

    • PBS base

    • 0.3 M Arginine for stabilization

    • pH 7.3-7.4

    • Addition of trehalose or similar protectants for lyophilization

Quality Control Metrics:

  • Glycosylation analysis by mass spectrometry or lectin binding

  • Functional verification through receptor binding assays

  • Thermostability assessment using differential scanning fluorimetry

  • Particle size analysis to confirm monodispersity

These optimized conditions typically yield 5-10 mg of purified protein per liter of mammalian cell culture, with >95% purity as determined by SDS-PAGE . The resulting protein should display proper glycosylation (migrating at 80-100 kDa despite a calculated mass of ~61.5 kDa) and retain full receptor-binding activity.

How should researchers design dose-response studies for HeV-G subunit vaccines to determine minimum effective doses?

Designing rigorous dose-response studies for HeV-G subunit vaccines requires a systematic approach to determine minimum effective doses that prevent both disease and viral shedding:

Study Design Framework:

  • Dose Range Selection:

    • Based on existing data, a log-scale dose range from 1-100 μg appears appropriate

    • Include at least 4-5 dose groups (e.g., 1, 4, 20, and 100 μg) as demonstrated in ferret studies

    • Include appropriate adjuvant-only and unvaccinated control groups

  • Vaccination Schedule:

    • Prime-boost regimen with 21-28 day intervals as used in successful protection studies

    • Consider evaluating single-dose protocols at higher doses for emergency use scenarios

  • Sampling Timeline:

    • Pre-vaccination (baseline)

    • 14 days post-prime

    • 14 days post-boost (pre-challenge)

    • Multiple time points post-challenge (days 1, 3, 5, 7, 10, 14, 21, and 28)

  • Challenge Parameters:

    • Challenge dose: 5,000 TCID50 of HeV has been established as a robust challenge dose

    • Route: Oronasal exposure to mimic natural infection

    • Timing: 21-28 days post-boost vaccination to ensure peak immunity

Outcome Measures (in order of priority):

  • Primary Endpoints:

    • Survival rate

    • Clinical disease prevention (fever, weight loss, respiratory signs, neurological signs)

    • Viremia (qRT-PCR and virus isolation from blood)

  • Secondary Endpoints:

    • Viral shedding in respiratory secretions (nasal swabs, throat swabs)

    • Virus presence in tissues at necropsy

    • Histopathological evidence of infection

  • Immunological Correlates:

    • Neutralizing antibody titers (pre- and post-challenge)

    • HeV-G-specific IgG ELISA titers

    • T-cell responses (IFN-γ ELISpot, intracellular cytokine staining)

Statistical Considerations:

  • Power analysis should aim for 80-90% power to detect 50% differences in protection

  • Typically requires 4-6 animals per group in ferret models; 4 animals per group for nonhuman primate studies

  • Survival analysis using Kaplan-Meier curves and log-rank tests

  • Correlation analysis between antibody titers and protection status

Data Interpretation Framework:

Protection LevelClinical DiseaseViremiaViral SheddingTissue Viral Load
CompleteNoneUndetectableUndetectableUndetectable
SubstantialNoneUndetectableTransient/LowUndetectable/Rare
PartialMild/ModerateDetectableDetectableDetectable
MinimalSevereHighHighWidespread
NoneFatalHighHighWidespread

Based on previous studies, researchers should expect complete protection at doses of 20-100 μg, with potential breakthrough shedding at lower doses (4 μg) . The minimum effective dose should be defined as the lowest dose that prevents both clinical disease AND viral shedding to interrupt potential transmission.

What are the critical quality attributes (CQAs) researchers should monitor when developing HeV-G proteins for vaccine applications?

Researchers developing HeV-G proteins for vaccine applications must establish and monitor several critical quality attributes (CQAs) to ensure consistent safety, potency, and stability:

Structural and Physical CQAs:

  • Primary Structure Integrity:

    • Amino acid sequence confirmation by mass spectrometry

    • N- and C-terminal sequence verification

    • Peptide mapping coverage >95%

  • Higher-Order Structure:

    • Secondary structure content by circular dichroism

    • Tertiary structure analysis by intrinsic fluorescence

    • Thermal stability profile (Tm) by differential scanning calorimetry

  • Size and Aggregation Profile:

    • Monomer content >90% by size exclusion chromatography

    • Aggregate profile by dynamic light scattering

    • Particle size distribution by nanoparticle tracking analysis

  • Glycosylation Pattern:

    • Site occupancy at N-linked glycosylation sites

    • Glycan composition and branching pattern

    • Sialic acid content and distribution

Functional CQAs:

  • Receptor Binding Activity:

    • Binding affinity (KD) to ephrin-B2 and ephrin-B3 by surface plasmon resonance

    • Relative receptor binding activity compared to reference standard

    • Competition binding assay results

  • Antigenic Integrity:

    • Binding to conformation-dependent neutralizing antibodies (e.g., m102.4)

    • Epitope mapping profile compared to reference standard

    • Antigenicity by ELISA using polyclonal sera from vaccinated animals

  • Immunological Potency:

    • In vitro potency assays (e.g., reporter cell-based assays)

    • Relative potency compared to reference standard that correlates with in vivo protection

Process-Related CQAs:

  • Purity:

    • Host cell protein content <100 ppm

    • Residual DNA <10 ng per dose

    • Endotoxin levels <0.25 EU per dose

    • Purity by SDS-PAGE >95%

  • Formulation Attributes:

    • pH stability profile (typically pH 7.3-7.4)

    • Osmolality

    • Excipient concentration (e.g., arginine, trehalose)

    • Appearance (clear, colorless solution)

Stability Indicators:

  • Real-Time Stability:

    • Accelerated and real-time stability data

    • Freeze-thaw stability (minimum 3 cycles)

    • Reconstitution stability for lyophilized formulations

  • Degradation Products:

    • Oxidized species profile

    • Deamidation levels

    • Fragmentation products

Acceptance Criteria Development:

Researchers should establish scientifically justified acceptance criteria for each CQA based on:

  • Data from batches used in successful animal studies

  • Process capability analysis from multiple manufacturing runs

  • Relationship to clinical performance in animal models

  • Regulatory requirements for vaccines

A comprehensive CQA monitoring program is essential for successful translation of research-grade HeV-G into clinical applications. The data suggests that maintaining proper glycosylation pattern and conformational epitopes recognized by neutralizing antibodies are among the most critical attributes for vaccine efficacy .

How should researchers interpret apparent molecular weight differences in HeV-G protein analysis?

Researchers frequently encounter discrepancies between the calculated and observed molecular weights of HeV-G proteins, which require careful interpretation:

Interpretation Guidelines:

  • Glycosylation Assessment:

    • The HeV-G contains multiple N-linked glycosylation sites that contribute substantially to molecular weight

    • Different expression systems produce varying glycosylation patterns:

      • Mammalian cells (HEK293): Complex glycans with sialic acids, resulting in 80-100 kDa apparent MW

      • Insect cells: Less complex glycans, typically resulting in 70-85 kDa apparent MW

      • Bacterial systems: No glycosylation, showing only the backbone MW (~61.5 kDa)

  • Analytical Approach:

    • Confirm glycosylation contribution through:

      • PNGase F treatment (removes N-linked glycans), which should reduce MW to near theoretical

      • Comparative analysis across different percentage gels (10%, 12%, 15%)

      • Western blot with glycan-specific and protein-specific antibodies

  • Expression System Considerations:

    • HeV-G produced in HEK293 cells represents the gold standard for research as it most closely resembles native viral glycosylation

    • Non-mammalian expression systems may yield proteins with altered receptor binding or immunological properties

  • Interpretation Table for HeV-G MW Analysis:

Observed MW (kDa)Likely ExplanationRecommended Action
80-100Fully glycosylated mature protein (optimal)Proceed with functional studies
65-75Partially glycosylated or altered glycosylationVerify function in receptor binding assays
~61.5Unglycosylated backbone or complete deglycosylationCheck expression system and culture conditions
Multiple bandsHeterogeneous glycosylation or degradationOptimize purification or expression conditions
>100Possible aggregation or dimerizationAnalyze under reducing/non-reducing conditions

When interpreting HeV-G analytical data, researchers should recognize that the apparent molecular weight of 80-100 kDa on SDS-PAGE for mammalian-expressed HeV-G is the expected result and indicates proper post-translational processing . Significant deviations from this pattern warrant further investigation of expression, purification, or storage conditions.

What approaches can researchers use to troubleshoot unexpected immunogenicity results with HeV-G vaccines?

When researchers encounter unexpected immunogenicity results with HeV-G vaccines, a systematic troubleshooting approach is essential:

Common Unexpected Results and Troubleshooting Strategies:

  • Low Neutralizing Antibody Titers Despite High Binding Antibodies:

    Potential Causes:

    • Conformational changes in critical epitopes

    • Improper adjuvant selection

    • Suboptimal immunization schedule

    Troubleshooting Approaches:

    • Verify protein conformation by binding to conformation-dependent antibodies like m102.4

    • Assess receptor binding function to confirm native-like structure

    • Compare adjuvant formulations (e.g., try CpG addition to Alhydrogel as shown effective)

    • Extend interval between prime and boost (from 21 to 28-35 days)

    • Perform epitope mapping of induced antibodies

  • Failure to Protect Despite Adequate Antibody Titers:

    Potential Causes:

    • Antibodies targeting non-neutralizing epitopes

    • Low antibody avidity

    • Cell-mediated immunity deficiency

    • Challenge strain variation

    Troubleshooting Approaches:

    • Determine antibody avidity index using chaotropic ELISAs

    • Assess neutralization against the specific challenge strain

    • Evaluate T-cell responses (IFN-γ ELISpot or flow cytometry)

    • Sequence the challenge virus G protein to identify potential variations

    • Consider passive transfer studies to confirm antibody-mediated protection

  • Variable Responses Within Treatment Groups:

    Potential Causes:

    • Inconsistent vaccine formulation

    • Variable vaccine stability

    • Host genetic factors

    • Inconsistent immunization technique

    Troubleshooting Approaches:

    • Verify protein stability under storage conditions

    • Confirm dose consistency through quantitative analysis

    • Standardize immunization protocols and techniques

    • Consider MHC typing or immunogenetic analysis of animals

    • Increase group size to account for biological variation

  • Protection Without Sterilizing Immunity:

    Potential Causes:

    • Insufficient dose (as seen with 4 μg dose allowing nasal shedding)

    • Suboptimal mucosal immunity

    • Incomplete neutralizing antibody coverage

    Troubleshooting Approaches:

    • Dose escalation studies to determine minimal dose for sterilizing immunity

    • Evaluate mucosal IgA responses in nasal secretions

    • Consider alternative delivery routes (intranasal in addition to parenteral)

    • Test combination approaches with F protein inclusion

Systematic Investigation Framework:

  • Analytical Assessment of Vaccine Product:

    • Confirm protein integrity, purity, and concentration

    • Verify conformational epitopes using monoclonal antibody binding

    • Assess aggregation state and glycosylation profile

  • Immunological Response Profiling:

    • Comprehensive antibody isotype analysis

    • Epitope-specific antibody mapping

    • Functional antibody assays (neutralization, ADCC, CDC)

    • T-cell response characterization (CD4, CD8, cytokine profiles)

  • Comparative Analysis:

    • Benchmark against successful formulations in previous studies

    • Analyze historical data from similar vaccine platforms

    • Consider species-specific differences in immune responses

By systematically addressing these potential issues, researchers can identify the root causes of unexpected immunogenicity results and optimize HeV-G vaccine formulations for consistent and protective immune responses.

What are the considerations for translating HeV-G vaccine findings from animal models to potential human applications?

Translating HeV-G vaccine findings from animal models to potential human applications requires careful consideration of several critical factors:

Immunological Translation Considerations:

  • Cross-Species Immunogenicity Correlations:

    • Neutralizing antibody titers that correlate with protection in animals (ferrets, nonhuman primates) need validation as correlates of protection for humans

    • The neutralizing antibody threshold established in African Green Monkeys (AGMs) provides the most relevant benchmark for human protection estimation

    • Comparison of immune response magnitudes across species must account for intrinsic immunological differences

  • Adjuvant Selection and Safety:

    • While CpG adjuvants enhanced responses in animal models , human-approved adjuvants with similar immunological profiles should be prioritized

    • Alum-based adjuvants (like Alhydrogel) have established human safety profiles and have shown efficacy with HeV-G

    • Novel adjuvant systems may require additional preclinical toxicology studies

  • Dosage Determination:

    • Allometric scaling from animal models suggests:

      • Ferret protective dose (20-100 μg) → Human equivalent: ~1-5 mg

      • AGM protective dose (10-100 μg) → Human equivalent: ~0.5-5 mg

    • Conservative approach would begin with the higher end of calculated ranges

Safety Translation Considerations:

  • Potential Immunopathology Risks:

    • No evidence of antibody-dependent enhancement was observed in any animal model

    • No vaccine-enhanced pathology was seen in challenge studies

    • Long-term follow-up of vaccinated animals showed no delayed adverse effects

  • Glycoprotein-Specific Safety Concerns:

    • HeV-G shares limited sequence homology with human proteins

    • No cross-reactivity with human ephrin receptors was observed in preclinical studies

    • Expression in mammalian systems with human-compatible glycosylation patterns minimizes potential immunogenicity of glycan structures

  • Pregnancy and Special Populations:

    • Reproductive toxicology studies are needed before inclusion of pregnant individuals

    • Pediatric safety bridging studies would be required for eventual use in children

Regulatory and Development Pathway:

  • Animal Rule Applicability:

    • HeV infection is rare, making traditional efficacy trials impractical

    • The FDA "Animal Rule" pathway may be appropriate, using animal efficacy data when human trials are not ethical or feasible

    • Robust animal models exist that recapitulate human disease

  • Manufacturing Considerations:

    • Transition from research-grade to GMP-grade production

    • Development of consistent glycosylation profiles in production cell lines

    • Scale-up challenges for mammalian cell culture systems

  • Clinical Development Strategy:

    PhasePrimary ObjectivesKey Considerations
    Phase 1Safety, tolerability, dose-rangingInitial dose based on animal data (100-250 μg) with 3-5 dose escalation
    Phase 2Immunogenicity, schedule optimizationPrime-boost intervals, comparison with animal correlates of protection
    Emergency UseLimited population accessConsider for high-risk laboratory workers, veterinarians
    LicensureBased on animal efficacy, human safetyEstablish robust correlates of protection
  • Integration with Existing Platforms:

    • Potential for inclusion in a broader henipavirus vaccine (with Nipah virus)

    • Development of combination approaches with F protein

    • Alignment with existing Equivac HeV horse vaccine strategies

The successful protective efficacy demonstrated in both ferret and nonhuman primate models provides strong justification for advancing HeV-G vaccines toward human applications . The evidence of protection in the AGM model is particularly significant as it represents the most human-relevant system tested to date . The existing compassionate use of the m102.4 monoclonal antibody in humans provides additional supportive evidence for the safety of targeting this viral protein .

What next-generation approaches might enhance HeV-G-based vaccine and therapeutic development?

Several innovative approaches hold promise for enhancing HeV-G-based vaccine and therapeutic development:

  • Structure-Guided Immunogen Design:

    • Utilizing the crystal structure data of HeV-G in complex with neutralizing antibodies to design stabilized prefusion conformations

    • Engineering "epitope-focused" immunogens that present key neutralizing epitopes while eliminating non-neutralizing or potentially harmful epitopes

    • Computational design of multi-epitope constructs that elicit broader neutralizing antibody responses

  • Novel Delivery Platforms:

    • mRNA-based delivery of HeV-G, leveraging technologies validated during COVID-19 vaccine development

    • Self-amplifying RNA systems for enhanced antigen expression and reduced dose requirements

    • Viral vectored approaches (VSV, adenovirus) for improved cellular immunity alongside neutralizing antibodies

    • Nanoparticle display of HeV-G trimers in native-like configuration for enhanced immunogenicity

  • Combination Approaches:

    • Bivalent vaccines incorporating both HeV-G and HeV-F glycoproteins for broader epitope coverage

    • Pan-henipavirus vaccines targeting conserved epitopes across HeV, NiV, and related viruses

    • Cocktail approaches combining active vaccination with monoclonal antibody prophylaxis

  • Therapeutic Advances:

    • Bispecific antibodies targeting multiple epitopes on HeV-G to prevent escape mutants

    • Antibody engineering for extended half-life and enhanced effector functions

    • Development of small molecule inhibitors targeting the receptor binding site identified from structural studies

    • Novel modalities like siRNA or CRISPR-based approaches targeting viral replication

  • Mucosal Immunity Enhancement:

    • Intranasal delivery systems to establish robust respiratory tract immunity

    • Adjuvant systems specifically designed to enhance mucosal IgA production

    • Prime-pull strategies to direct systemic immunity toward mucosal surfaces

  • Precision Glycoengineering:

    • Controlling glycosylation patterns to enhance immunogenicity while maintaining critical epitopes

    • Site-specific glycan modification to improve stability and antigenicity

    • Removal of glycan shields that may conceal important neutralizing epitopes

These next-generation approaches build upon the solid foundation of HeV-G research but may offer advantages in terms of manufacturing scalability, immunogenicity, or breadth of protection. The significant progress already made with recombinant HeV-G in multiple animal models provides a benchmark against which these novel approaches can be measured.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.