Recombinant Hepatitis B virus genotype A2 subtype adw Large envelope protein (S)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
S; Large envelope protein; L glycoprotein; L-HBsAg; LHB; Large S protein; Large surface protein; Major surface antigen
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-389
Protein Length
Full Length of Mature Protein
Species
Hepatitis B virus genotype A2 subtype adw (isolate Japan/Nishioka/1983) (HBV-A)
Target Names
S
Target Protein Sequence
GTNLSVPNPLGFLPDHQLDPAFGANSTNPDWDFNPIKDHWPAANQVGVGAFGPGLTPPHG GILGWSPQAQGILTTVSTIPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTALHQALQ DPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTGDPVTIMENITSGFLGPLLVLQAG FFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLR RFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSKFPSCC CTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMM WYWGPSLYSIVSPFIPLLPIFFCLWVYI
Uniprot No.

Target Background

Function
The hepatitis B virus large envelope protein (L protein) exists in two conformations: 'external' (Le-HBsAg) and 'internal' (Li-HBsAg). The external conformation mediates attachment to cellular receptors, initiating infection and determining species specificity and liver tropism. This attachment primarily occurs via caveolin-mediated endocytosis, followed by fusion between the virion and endosomal membranes. The internal conformation plays a role in virion morphogenesis, acting as a matrix protein to interact with the nucleocapsid. The middle envelope protein (M protein) is crucial for virion budding, independently of the nucleocapsid. This process often results in the formation of 22 nm subviral lipoprotein particles lacking a nucleocapsid.
Protein Families
Orthohepadnavirus major surface antigen family
Subcellular Location
Virion membrane.

Q&A

What characterizes HBV genotype A2 and subtype adw at the molecular level?

HBV genotype A2 belongs to genotype A, which is highly prevalent in Africa, Europe, India, and America . The "adw" designation refers to a specific serological subtype based on the antigenic determinants present in the hepatitis B surface antigen (HBsAg) . Serological classification of HBV identifies four primary subtypes: adw, adr, ayw, and ayr, based on two pairs of mutually exclusive determinants (d/y and w/r) .

Genetically, HBV genotypes are defined by sequence divergence of >8% in the complete genome or 4-8% in the S gene region . Genotype A shows distinctive characteristics including:

  • Higher tendency for recombination compared to other genotypes

  • Association with viral persistence following acute hepatitis B infection (80% persistence rate for genotype A versus only 20% for genotype D)

  • Higher rates of sustained remission after HBeAg seroconversion (55% for genotype A versus 32% for genotype D)

  • Greater expression levels of HBsAg compared to other genotypes, particularly genotype D

For researchers, it is essential to understand that these molecular characteristics influence the behavior of recombinant proteins in experimental systems, potentially affecting binding affinity, protein stability, and immunological responses.

How does the structure-function relationship of the Large envelope protein differ from Small and Middle envelope proteins?

The Large (L) envelope protein of HBV serves as a critical molecular platform that coordinates the recruitment of Small (S) envelope proteins and core proteins within the perinuclear environment during virion assembly . This orchestrating function demonstrates that L protein is not merely a structural component but plays an active role in the organization of viral assembly.

The L protein contains three domains: preS1, preS2, and S. By comparison:

  • Small (S) protein contains only the S domain

  • Middle (M) protein contains the preS2 and S domains

  • Large (L) protein contains all three domains (preS1, preS2, and S)

Functional studies have demonstrated that:

  • The L protein is essential for infectivity, as it contains the complete open reading frame required for this function

  • Direct interactions between specific amino acid residues in the core protein (including L60, L95, K96, I126, and Y132) and the L protein are critical for virion formation

  • The L protein can be produced from HBV DNA sequences naturally integrated into host genomes, potentially supporting viral persistence even when active viral replication is suppressed

Understanding these structural relationships is crucial when designing experiments involving recombinant envelope proteins, as truncations or modifications may significantly alter protein-protein interactions and functional properties.

What expression systems yield optimal results for producing recombinant HBV envelope proteins?

Saccharomyces cerevisiae represents one of the most widely utilized expression systems for producing recombinant HBV envelope proteins, including the genotype A2 subtype adw Large envelope protein . This yeast-based system offers several methodological advantages:

  • Post-translational processing capabilities that permit proper folding and modification of viral envelope proteins

  • Scalable protein production with relatively high yields

  • Established purification workflows including:

    • Ionic exchange chromatography for initial capture

    • Size exclusion chromatography for polishing and removal of aggregates

    • Sterile filtration for final preparation

The downstream processing protocol typically includes:

Purification StageMethodPurpose
Initial CaptureIonic Exchange ChromatographySeparation based on protein charge
Intermediate PurificationSize Exclusion ChromatographyRemoval of aggregates and separation by molecular size
Final PolishingSterile FiltrationRemoval of microbial contaminants and preparation for storage

Researchers should note that the expression system can influence the glycosylation pattern and antigenic properties of the recombinant protein. For certain applications, mammalian expression systems such as HEK293 or CHO cells may offer advantages when native glycosylation patterns are required, though these systems are not explicitly mentioned in the provided search results.

What methods are most effective for confirming the identity and integrity of recombinant HBV envelope proteins?

Confirmation of recombinant HBV envelope protein identity and integrity requires a multi-faceted analytical approach. Based on standard recombinant protein characterization protocols applicable to viral envelope proteins:

  • Immunological verification:

    • Western blotting using antibodies specific to the HBV Large envelope protein

    • ELISA assays to confirm antigenic determinants, particularly for the adw subtype

  • Biochemical characterization:

    • SDS-PAGE for molecular weight determination and purity assessment

    • Mass spectrometry for precise molecular mass and potential post-translational modifications

    • Circular dichroism spectroscopy for secondary structure analysis

  • Functional assessment:

    • Binding assays with hepatocyte receptors or antibodies

    • Analysis of particle formation by electron microscopy

    • Infectivity studies in cell culture models or by evaluating the ability to support Hepatitis Delta Virus (HDV) infection

When evaluating integrity, researchers should pay particular attention to the preservation of conformational epitopes that are often disrupted during recombinant protein production and purification. Proper storage in appropriate buffer conditions (typically phosphate-buffered saline with minimal preservatives like sodium azide) is crucial for maintaining protein stability .

How do the replication characteristics of genotype A2 compare with other HBV genotypes in experimental systems?

Comparative analyses of HBV genotypes have revealed distinct replication phenotypes that may contribute to genotype-specific pathogenesis and clinical outcomes. In vitro studies using replication-competent 1.3-mer cDNA clones have identified striking differences in replicative capacity across major genotypes:

  • Genotype C exhibits higher intracellular expression of HBV DNA compared to genotype B

  • Similarly, genotype D shows higher intracellular DNA expression than genotype A

  • More recent studies using 1.3-mer clones of genotypes A2, B2, C2, D3, and the novel genotype J have revealed marked variations in:

    • Replicative capacity

    • HBeAg expression

    • Surface protein (HBsAg) expression

The differences in replication observed between studies may relate to experimental methodology. For example:

These variations highlight the importance of standardized experimental systems when comparing different HBV genotypes. Researchers working with genotype A2 should be aware that its replication characteristics may differ significantly from other genotypes, potentially influencing experimental outcomes and interpretations.

What are the critical amino acid residues in the Large envelope protein that mediate interactions with the HBV core protein?

Research has identified specific amino acid residues in the HBV core protein that are essential for direct interaction with the Large envelope protein. Co-immunoprecipitation studies and confocal microscopy analyses have revealed that several core protein residues are crucial for this interaction:

  • Tyrosine 132 (Y132) - also known to be essential for capsid formation

  • Leucine 60 (L60)

  • Leucine 95 (L95)

  • Lysine 96 (K96)

  • Isoleucine 126 (I126)

These amino acid residues likely form contact points with corresponding regions in the Large envelope protein, although the specific binding sites within the L protein have not been fully elucidated in the provided search results.

The interaction between the core and envelope proteins occurs in a perinuclear environment, where the L protein acts as a molecular scaffold for recruiting both S proteins and core proteins . This tripartite interaction (L-S-core) is fundamental to the process of virion assembly and maturation.

Researchers investigating structure-function relationships or developing antivirals targeting viral assembly should focus on these critical residues as potential targets for intervention. Mutagenesis studies altering these residues could provide valuable insights into the mechanics of virus assembly and potential vulnerabilities in the viral life cycle.

How can researchers differentiate between the effects of envelope protein variation and host factors in HBV infection models?

Differentiating between the effects of viral envelope protein variation and host factors requires carefully designed experimental approaches. Based on research methodologies used in HBV studies:

  • Isogenic experimental systems:

    • Utilize identical host cell backgrounds (e.g., Huh7 cells) while varying only the viral component through transfection of different genotype/subtype constructs

    • This approach isolates the effect of viral variation by keeping host factors constant

  • Comparative transfection studies:

    • Transiently produce wild-type or mutant L, S, or core proteins separately or in combination

    • Analyze protein localization by confocal microscopy

    • Assess protein-protein interactions via co-immunoprecipitation

    • These methods can reveal specific contributions of viral protein variants

  • Cross-species models:

    • Test the same viral constructs in different cell lines or animal models to evaluate host factor influences

    • Compare replication efficiency, protein expression, and virion production across different host backgrounds

  • CRISPR/Cas9 modification of host factors:

    • Systematically knock out or modify specific host factors in otherwise identical cellular backgrounds

    • Challenge these modified cells with standardized viral constructs

    • This approach can identify essential host dependencies for specific viral genotypes/subtypes

  • Chimeric virus construction:

    • Create chimeric viruses by swapping envelope protein domains between different genotypes

    • Test these chimeras in standardized cell systems to map functional domains that interact with specific host factors

By implementing these complementary approaches, researchers can systematically disentangle the complex interplay between viral envelope protein variation and host cellular factors in determining infection outcomes.

What methods are most effective for studying the assembly dynamics of HBV particles containing genotype A2 envelope proteins?

Studying assembly dynamics of HBV particles containing genotype A2 envelope proteins requires sophisticated methodological approaches that capture the temporal and spatial aspects of virion formation:

  • Live-cell imaging techniques:

    • Fluorescently tagged envelope proteins (particularly the Large envelope protein) can be visualized in real-time during assembly

    • Dual-color labeling of core and envelope proteins enables tracking of co-localization during particle formation

    • FRET (Förster Resonance Energy Transfer) analysis can detect direct protein-protein interactions at nanometer scale

  • Biochemical fractionation and ultracentrifugation:

    • Density gradient ultracentrifugation separates different assembly intermediates

    • Sequential sampling during assembly allows for tracking of assembly progression

    • Western blot analysis of fractions provides quantitative assessment of protein incorporation into particles

  • Cryo-electron microscopy:

    • Direct visualization of particle morphology at different assembly stages

    • Structural analysis of envelope protein arrangement on virus particles

    • Comparison of genotype A2 particle structure with other genotypes

  • Pulse-chase experiments:

    • Metabolic labeling of newly synthesized proteins during defined time windows

    • Immunoprecipitation at various time points to track protein incorporation into assembling particles

    • This approach reveals the kinetics of assembly and maturation

  • In vitro assembly systems:

    • Purified recombinant components (core and envelope proteins) can be mixed under controlled conditions

    • Assembly can be monitored by light scattering, electron microscopy, or analytical ultracentrifugation

    • This approach allows precise manipulation of protein concentrations and buffer conditions

When studying genotype A2 specifically, researchers should account for its distinctive characteristics, including potentially higher HBsAg expression levels compared to other genotypes and genotype-specific interactions between envelope and core proteins that may influence assembly kinetics.

How do mutations in the Large envelope protein affect HBV assembly, secretion, and infectivity?

Mutations in the HBV Large envelope protein can profoundly impact multiple aspects of the viral life cycle. While the search results don't specifically address all mutations in genotype A2 Large envelope protein, general principles can be applied based on HBV envelope protein studies:

  • Assembly effects:

    • Mutations in regions interacting with the core protein (particularly those that interact with core residues L60, L95, K96, I126, and Y132) can disrupt the recruitment of capsids to assembly sites

    • Alterations in the transmembrane domains may affect protein topology and incorporation into membranes during budding

  • Secretion impacts:

    • Pre-S deletion mutations found at higher frequencies in genotypes C and D compared to A and B can influence particle secretion efficiency

    • Overexpression or improper folding of mutant L proteins can lead to retention in the endoplasmic reticulum, causing secretion defects

  • Infectivity consequences:

    • The complete open reading frame for the L protein is essential for infectivity

    • Truncations in the L protein, as observed in some naturally integrated HBV sequences (e.g., in Hep3B cells), can result in fusion proteins with altered functionality

    • Mutations in the preS1 domain, which contains the receptor binding site, directly impact infectivity

  • Co-factor dependencies:

    • Some L protein mutations may alter dependence on host factors for assembly and secretion

    • Genotype-specific mutations might influence interactions with cellular chaperones and ESCRT machinery

Interestingly, research has demonstrated that functional envelope proteins can be produced from naturally integrated HBV DNA sequences, even in the absence of active viral replication . This finding has significant implications for chronic Hepatitis Delta Virus (HDV) infections, as HDV can persist using envelope proteins supplied by integrated HBV sequences even when HBV replication is suppressed by antiviral therapy .

For researchers working with genotype A2 envelope proteins, it's important to consider that this genotype may have distinctive mutation patterns and functional consequences compared to other genotypes, potentially influencing experimental outcomes in assembly and infectivity studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.