Recombinant Hepatitis B virus genotype B1 subtype adw Large envelope protein (S)

Shipped with Ice Packs
In Stock

Description

Production and Purification

The protein is produced via recombinant DNA technology in distinct host systems:

ParameterE. coli System HEK293 System
TagN-terminal His-tagC-terminal His-tag
Purity>90% (SDS-PAGE)>95% (IMAC purification)
Molecular Weight~20–40 kDa (glycosylated smear)~20–40 kDa (glycosylated smear)
StorageLyophilized, -20°C/-80°CLyophilized, -20°C/-80°C
  • Reconstitution: Recommended in deionized water (0.1–1.0 mg/mL) with 50% glycerol for long-term storage .

  • Buffer: Tris/PBS-based (pH 8.0) with 6% trehalose .

Functional Roles and Genotype-Specific Characteristics

The protein’s functions are influenced by HBV genotype and subtype variability:

Genotype B1 Subtype adw-Specific Traits

  • Replication and Secretion:

    • C-Type preS1 (associated with B1):

      • Higher Intracellular HBsAg Retention: Spotty cytoplasmic aggregation reduces extracellular HBsAg secretion .

      • Reduced Infectivity: Lower extracellular HBV DNA levels compared to D/E-type strains .

  • Antigenic Determinants:

    • adw Subtype: Defined by "d" and "w" epitopes in the S domain .

Comparative Genotype Effects

GenotypepreS1 N-TerminusHBsAg SecretionInfectivity
B1 (C-type)GTA/GTC-likeLowLow
D-typeGTD-likeHighHigh
E-typeGTE-likeHighHigh

Data adapted from studies on preS1 N-terminal sequence effects .

Vaccine and Therapeutic Development

  • PreS1-Specific Antibodies: Recombinant LHBsAg is used to develop monoclonal antibodies targeting preS1 for therapeutic or diagnostic applications (e.g., neutralizing HBV entry) .

  • Vaccine Components: While current vaccines focus on small HBsAg (SHBsAg), LHBsAg is explored for enhanced immune responses .

Mechanistic Studies

  • Viral Morphogenesis:

    • Capsid Interaction: preS2 domain facilitates capsid-LHBsAg interaction during virion assembly .

    • Entry Receptor Binding: preS1 mediates attachment to heparan sulfate proteoglycans and NTCP receptors .

  • Genotype-Dependent Pathogenesis:

    • Genotype B (B1/B2): Linked to lower HBeAg seroconversion rates and higher liver disease progression .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All protein shipments include standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
S; Large envelope protein; L glycoprotein; L-HBsAg; LHB; Large S protein; Large surface protein; Major surface antigen
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-389
Protein Length
Full Length of Mature Protein
Species
Hepatitis B virus genotype B1 subtype adw (isolate Japan/pJDW233/1988) (HBV-B)
Target Names
S
Target Protein Sequence
GTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDAHKVGVGAFGPGFTPPHG GLLGWSPQAQGILTSVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAG FFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLR RFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCC CTKPMDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMM WYWGPSLYNILSPFMPLLPIFFCLWVYI
Uniprot No.

Target Background

Function

The Hepatitis B virus large envelope protein (L protein) exists in two conformations: 'external' (Le-HBsAg) and 'internal' (Li-HBsAg). The external conformation mediates virus attachment to cell receptors, initiating infection and determining species specificity and liver tropism. This interaction triggers virion internalization primarily via caveolin-mediated endocytosis. Furthermore, the L protein facilitates fusion between the virion and endosomal membranes. In its internal conformation, the L protein contributes to virion morphogenesis and interacts with the nucleocapsid, functioning similarly to a matrix protein.

The middle envelope protein (M protein) plays a crucial role in virion budding, inducing budding independently of the nucleocapsid. This process primarily results in the formation of 22 nm diameter subviral lipoprotein particles lacking a nucleocapsid.

Protein Families
Orthohepadnavirus major surface antigen family
Subcellular Location
Virion membrane.

Q&A

What are the HBV envelope proteins and what roles do they serve?

HBV produces three envelope proteins: Large (L), Middle (M), and Small (S), all of which share the C-terminal S domain. The L protein contains additional N-terminal PreS1 and PreS2 domains, making it crucial for viral attachment and entry into hepatocytes. The S protein (HBsAg) is the most abundant envelope protein and forms the primary component of the viral surface. These proteins collectively mediate cellular attachment and entry of HBV, making them primary targets for neutralizing antibodies that provide immunity after infection or vaccination .

How is the L protein organized structurally, and what domains are important for its function?

The L protein consists of three domains: the PreS1 (108-119 amino acids depending on genotype), PreS2 (55 amino acids), and S domain (226 amino acids). NMR studies have revealed that the PreS domains are intrinsically disordered proteins with no stable secondary structure, which is important for their flexibility in receptor binding . The S domain, in contrast, contains multiple transmembrane regions that anchor the protein in the lipid membrane. The PreS1 domain contains the receptor binding site essential for viral entry into hepatocytes, while the S domain is primarily responsible for self-assembly into virus-like particles (VLPs) .

What is known about genotype B1 subtype adw specifically?

HBV is classified into 8 genotypes (A-H) with about 25 subgenotypes. The subtype adw (including adw2 and adw4) represents a serological classification based on antigenic determinants of HBsAg. While specific information about genotype B1 subtype adw is limited in the search results, research shows that genotype distribution varies geographically, with genotype D being dominant in certain regions (particularly D1 in Turkey), and serological subtype ayw2 being most prevalent in those populations . Different genotypes/subgenotypes may affect viral transmission, disease progression, and response to treatment, making their identification important for epidemiological and clinical studies .

What expression systems are available for producing recombinant HBV envelope proteins?

Three main expression systems have been employed for recombinant HBV envelope protein production:

  • Mammalian cell systems: Provide proper post-translational modifications and folding, resulting in proteins that closely resemble the native viral proteins. These systems allow for the production of correctly assembled virus-like particles (VLPs) with preserved conformational epitopes .

  • Yeast systems: Offer higher yields but may produce proteins with differences in glycosylation patterns compared to mammalian-derived proteins .

  • Bacterial systems: Can be used for producing specific domains or epitopes, but often struggle with proper folding of the complete envelope proteins. They can be complemented with kinases (such as MAPK14) for introducing specific post-translational modifications like phosphorylation .

Research has shown that the source of HBsAg significantly affects its performance in diagnostic applications, with mammalian-expressed S-HBsAg VLPs demonstrating higher sensitivity and specificity in multiplex serology compared to yeast or serum-derived HBsAg .

What is the recommended method for producing S-HBsAg VLPs in mammalian cells?

A streamlined method for producing S-HBsAg VLPs involves:

  • Transient transfection of mammalian cells (such as 293T cells) with expression plasmids encoding the S-HBsAg.

  • Harvesting cells approximately 48-72 hours post-transfection.

  • Cell lysis and clarification of the lysate.

  • Purification of the VLPs from the cell lysate using affinity chromatography or density gradient centrifugation.

  • Characterization of the purified VLPs by transmission electron microscopy and mass photometry to verify proper assembly .

This method produces uniform S-HBsAg VLPs with properly displayed antigenic epitopes, making them superior for serological detection of anti-HBs antibodies compared to alternative sources .

How can researchers assess the quality and conformation of purified recombinant HBV envelope proteins?

Multiple complementary techniques should be employed:

  • Transmission electron microscopy (TEM): Visualizes the assembly status and morphology of VLPs.

  • Mass photometry: Provides quantitative data on particle size distribution and homogeneity.

  • Circular dichroism spectroscopy: Evaluates secondary structure and thermal stability at different pH conditions.

  • Functional serological assays: Measures the ability to detect anti-HBs antibodies in multiplex serology or ELISA formats.

  • NMR spectroscopy: Particularly useful for analyzing the structure of PreS domains .

These techniques collectively provide a comprehensive assessment of protein quality, structural integrity, and functional capacity.

What post-translational modifications occur in HBV L protein, and how do they affect function?

The HBV L protein undergoes several post-translational modifications, with phosphorylation being particularly significant. Mass spectrometry and NMR studies have identified nine phosphorylation sites in the PreS domain, with S6 and S98 being major sites, and T27, T57, S67, T95, T145, T146, and S148 representing minor sites . These phosphorylation events occur in all major functional regions of PreS, suggesting they may regulate various functions including receptor binding, membrane translocation, and virion assembly. The specific kinases involved likely include cdk5 and MAPK14 .

How can phosphorylated forms of the HBV L protein be produced for research studies?

Two approaches have been developed:

  • Cell-free protein synthesis using wheat germ extract: This system contains endogenous kinases that naturally phosphorylate the PreS domain at multiple sites.

  • Bacterial co-expression system: Co-expressing the PreS domain with MAPK14 kinase in E. coli can introduce phosphorylation at specific sites.

What techniques are most effective for mapping phosphorylation sites in HBV envelope proteins?

A combination of complementary techniques provides the most comprehensive mapping:

  • LC-MS/MS mass spectrometry: Identifies specific phosphorylated residues by detecting the mass shift associated with phosphorylation.

  • MALDI-TOF analysis: Determines the number of phosphorylation sites and their relative abundance.

  • NMR spectroscopy: Provides site-specific information on phosphorylation by detecting chemical shift changes in the affected residues and neighboring amino acids.

These techniques together enable differentiation between major and minor phosphorylation sites and their precise localization within the protein sequence .

How are recombinant HBV envelope proteins utilized in serological diagnostics?

Recombinant HBV envelope proteins, particularly S-HBsAg VLPs, serve as essential reagents in diagnostic assays designed to:

  • Detect anti-HBs antibodies to assess immunity following vaccination or natural infection.

  • Screen blood donations for HBV exposure.

  • Monitor the efficacy of HBV vaccination.

The quality of the recombinant antigen significantly impacts test performance. Mammalian cell-derived S-HBsAg VLPs have demonstrated superior sensitivity and specificity compared to yeast or serum-derived antigens in multiplex serology, making them the preferred choice for analyzing HBV immunity through anti-HBs serostatus .

How can multiepitope recombinant proteins be designed for improved HBV diagnostics?

A recombinant multiepitope hepatitis B (rMEHB) antigen can be designed by:

  • Identifying immunodominant epitopes from HBV core and envelope proteins.

  • Designing a synthetic gene that encodes these epitopes in a single continuous protein.

  • Adding an affinity tag (such as 6xHis) to facilitate purification.

  • Expressing the construct in E. coli or other suitable expression systems.

  • Purifying the protein using affinity chromatography.

Such multiepitope proteins can detect both anti-HBc-IgM (indicating acute infection) and anti-HBc-IgG (indicating past exposure), providing comprehensive diagnostic information. Thermal stability studies using circular dichroism spectroscopy can identify optimal pH conditions for ELISA applications .

How can HBV envelope proteins be incorporated into pseudotyped viruses for entry studies?

HBV envelope proteins can be assembled onto lentivirus pseudotype particles through a three-plasmid transfection system:

  • Transfect 293T cells with:

    • An HIV packaging construct

    • A transfer plasmid expressing a reporter gene

    • A plasmid expressing L, M, and S HBV envelope proteins

  • After approximately 48 hours, harvest the culture supernatant containing pseudotyped particles.

  • Use the particles to infect primary human hepatocytes (PHH) or other target cells.

This system faithfully recapitulates the envelope-directed specificity of HBV entry, with pseudotyped particles infecting PHH but not other cell types. This approach can be used to study HBV attachment and entry mechanisms and potentially deliver specific sequences to hepatocytes for gene therapy applications .

What are the critical differences between recombinant and serum-derived HBsAg particles?

Transmission electron microscopy and mass photometry analyses have revealed distinct differences between recombinant and serum-isolated HBsAg VLPs:

  • Assembly patterns: Recombinant and serum-derived VLPs show different assembly structures, which affects their antigenic presentation.

  • Epitope display: Mammalian cell-expressed recombinant S-HBsAg VLPs typically display uniform antigenic epitopes on their surface, while serum-derived particles may exhibit greater heterogeneity.

  • Antigenic quality: The source of HBsAg significantly impacts the antigenic quality, with mammalian-expressed recombinant S-HBsAg VLPs often demonstrating superior performance in detecting anti-HBs antibodies compared to serum-derived or yeast-expressed alternatives .

Understanding these differences is crucial when selecting appropriate materials for diagnostic or vaccine development applications.

How do different HBV genotypes and subtypes impact research and diagnostic applications?

HBV genotypes and subtypes show significant diversity that affects research and diagnostics:

  • Geographic distribution: Different regions show predominance of specific genotypes and subtypes. For example, genotype D (particularly subgenotype D1) is dominant in Turkey, with HBsAg subtype ayw2 being most prevalent .

  • Transmission dynamics: Genotypes/subgenotypes may vary in their transmission patterns and epidemiological characteristics.

  • Diagnostic implications: Antibodies raised against one genotype may have different affinities for antigens derived from other genotypes, potentially affecting diagnostic sensitivity.

  • Research considerations: Studies on viral entry, replication, and pathogenesis must consider genotype-specific differences to ensure relevance to global HBV infections .

Researchers must consider these variations when designing experimental systems and interpreting results, particularly when working with specific genotypes like B1 subtype adw.

What methodological considerations are important when using PreS domains for structural studies?

The intrinsically disordered nature of PreS domains presents specific challenges for structural studies:

  • Expression strategy: While bacterial expression can provide sufficient quantities for structural analysis, the lack of post-translational modifications may affect function.

  • Purification approach: PreS domains can be efficiently purified using affinity tags, but care must be taken to avoid aggregation or misfolding.

  • Structural characterization: Because PreS domains lack stable secondary structure elements, traditional crystallography is challenging. NMR spectroscopy is better suited for characterizing these domains, revealing their intrinsically disordered nature with 1H N resonances observed in a narrow chemical shift range (7.5-8.5 ppm) .

  • Phosphorylation analysis: When studying phosphorylated forms, a combination of mass spectrometry and NMR provides the most comprehensive characterization .

These considerations are essential for researchers aiming to conduct structural studies on the PreS domains of the L protein from any HBV genotype, including B1 subtype adw.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.