Recombinant Hepatitis B virus genotype B2 Large envelope protein (S)

Shipped with Ice Packs
In Stock

Description

Molecular Structure and Genetic Features

The HBV large envelope protein (L-HBsAg) consists of three domains:

  • Pre-S1 (108–119 amino acids): Mediates viral attachment to hepatocytes via sodium taurocholate cotransporting polypeptide (NTCP) receptors .

  • Pre-S2 (55 amino acids): Facilitates membrane fusion and contains immunogenic epitopes .

  • S domain (226 amino acids): Forms the major antigenic "a determinant" loop (aa 122–148), critical for antibody neutralization .

For genotype B2, the L-HBsAg sequence includes unique residues in the pre-S1 region (e.g., Thr113, Pro120) that influence receptor binding efficiency . Recombinant versions retain these genotype-specific motifs while incorporating tags (e.g., His-tag) for purification .

Viral Entry and Replication

  • Genotype B2 L-HBsAg exhibits higher intracellular HBV DNA accumulation compared to genotypes A2 and C1, correlating with enhanced replication efficiency .

  • Pre-S1 mutations (e.g., G119E) in B2 enhance NTCP binding, increasing infectivity in hepatocyte models .

Immune Evasion and Antigenicity

  • B2 L-HBsAg shows lower HBsAg secretion versus genotype C, promoting immune tolerance and chronic infection .

  • Pre-S2 deletions in B2 reduce MHC class II presentation, dampening T-cell responses .

Expression Systems

ParameterDetailsSource
HostE. coli or yeast systems (common for high yield)
Purity>85% via SDS-PAGE, with endotoxin removal protocols
TagN-terminal His-tag for affinity chromatography

Functional Studies

  • In vitro models: Transfection of recombinant B2 L-HBsAg into Huh7 cells induces apoptosis via caspase-3/Bax upregulation, mimicking clinical liver injury .

  • Vaccine development: Pre-S1/Pre-S2 domains in recombinant proteins elicit neutralizing antibodies across HBV genotypes (A–H), overcoming non-response to S-only vaccines .

Genotype-Specific Virological Comparisons

FeatureGenotype B2Genotype CGenotype D
Replication capacityHighest intracellular HBV DNAModerateHigh (similar to B2)
HBsAg secretionLowHighLowest among genotypes
Pre-S deletionsRareFrequent (linked to HCC) Common in chronic phases

Clinical and Research Implications

  • Diagnostics: Recombinant B2 L-HBsAg improves serological assays for detecting genotype-specific antibodies in Asia-Pacific populations .

  • Therapeutic targets: Pre-S1 inhibitors (e.g., Myrcludex B) block NTCP binding, reducing B2 infectivity in preclinical trials .

  • Vaccine design: Incorporating Pre-S domains enhances immunogenicity, particularly in hypo-responsive cohorts .

Challenges and Future Directions

  • Mutation monitoring: Pre-S1 G145R mutations in B2 evade vaccine-induced immunity, necessitating real-time surveillance .

  • Animal models: Humanized liver mice transfected with recombinant B2 L-HBsAg show accelerated fibrosis, aiding pathogenesis studies .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format readily available in stock. If you have a specific format preference, please indicate it in your order remarks. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipment, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoted for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
S; Large envelope protein; L glycoprotein; L-HBsAg; LHB; Large S protein; Large surface protein; Major surface antigen
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-389
Protein Length
Full Length of Mature Protein
Species
Hepatitis B virus genotype B2 (isolate Indonesia/pIDW420/1988) (HBV-B)
Target Names
S
Target Protein Sequence
GTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDNWPDSNKVGVGAFGPGFTPPHG GLLGWSPQAQGILTTVPTAPPPASTNRQLGRKPTPLSPPLRDTHPQAMQWNSTTFHQTLQ DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSTTGDPVPNMENIASGLLGPLLVLQAG FFSLTKILTIPLSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLR RFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCC CTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMM WFWGPSLYNILSPFMPLLPIFFCLWVYI
Uniprot No.

Target Background

Function
The large envelope protein exists in two topological conformations: 'external' or Le-HBsAg and 'internal' or Li-HBsAg. In its external conformation, the protein binds to cell receptors, initiating infection. This interaction dictates the species specificity and liver tropism. This attachment triggers virion internalization primarily through caveolin-mediated endocytosis. The large envelope protein also facilitates fusion between the virion membrane and endosomal membrane. In its internal conformation, the protein contributes to virion morphogenesis and acts as a matrix protein, mediating contact with the nucleocapsid. The middle envelope protein plays a critical role in virion budding. It induces budding independently of the nucleocapsid, leading to the formation of subviral lipoprotein particles measuring 22 nm in diameter that lack a nucleocapsid.
Protein Families
Orthohepadnavirus major surface antigen family
Subcellular Location
Virion membrane.

Q&A

What are the distinguishing characteristics of HBV genotype B2 compared to other genotypes?

Hepatitis B virus genotype B2 exhibits several distinctive characteristics compared to other genotypes. Genotype B2 demonstrates a significantly higher replication capacity than genotypes A2 and C1, with studies showing it produces the highest intracellular HBV DNA levels among common genotypes . When comparing cccDNA levels, genotype B2 alongside genotype F1b shows approximately a 2-fold increase compared to genotypes A2, C1, and D1 . Additionally, genotype B2 expresses the lowest Precore RNA levels, with studies documenting a 100-fold reduction compared to genotype A2 . At the protein level, genotype B2 exhibits high intracellular HBsAg levels similar to genotype A2, but with a notably different intra/extracellular antigen ratio, retaining approximately 5-20% of antigens intracellularly compared to genotype A2's 50% .

How does the structure of the Large envelope protein differ in HBV genotype B2?

The Large envelope protein (LHBs) of HBV genotype B2 is encoded by the 2.4-kb mRNA regulated by Surface promoter I (SPI) . While the search results don't provide specific structural differences of the Large envelope protein in genotype B2, comparative studies across genotypes have shown that the regulation and expression of HBsAg (which includes the Large envelope protein) varies significantly between genotypes. The LHBs contains three domains: the preS1 domain (108-119 amino acids depending on genotype), the preS2 domain (55 amino acids), and the S domain (226 amino acids). Research suggests genotype-specific variations in these domains may influence viral particle assembly, receptor binding, and immunogenicity .

What are the established methodologies for producing recombinant HBV genotype B2 Large envelope protein?

The production of recombinant HBV genotype B2 Large envelope protein typically involves transfection of hepatoma cell lines with unit-length viral constructs or expression vectors. Several established methodologies have been documented in the research literature: (1) Transfection of HuH-7 or HepG2 cells with unit-length constructs carrying the complete B2 genome, as these cell lines have been validated to effectively drive HBV promoter expression ; (2) Generation of recombinant baculoviruses carrying replication-defective HBV genomes and HBV packaging genes to deliver HBV DNA into hepatoma cell lines ; (3) Construction of expression vectors containing the Large envelope protein gene under control of specific promoters, optimized for expression in mammalian systems . For purification, researchers typically employ affinity chromatography techniques followed by verification using specific PCR reactions, Western blot analysis, and electron microscopy to confirm the integrity and authenticity of the recombinant protein .

What are the optimal cell culture systems for studying functional properties of recombinant HBV genotype B2 Large envelope protein?

The optimal cell culture systems for studying the functional properties of recombinant HBV genotype B2 Large envelope protein are primarily hepatoma-derived cell lines. Based on extensive comparative analyses, HuH-7 and HepG2 cells have emerged as the most suitable systems, as they are capable of driving expression from all HBV promoters, including those regulating the Large envelope protein . Studies have demonstrated that non-hepatic cell lines like Chang Liver, Chinese Hamster Ovary (CHO), HeLa, Ost-7, and Sf9 cells are significantly less effective for this purpose .

When conducting functional studies, it's crucial to consider that HuH-7 and HepG2 cells may exhibit subtle differences in protein processing and secretion patterns. Research has shown that transfection of identical genotype B2 constructs in these two cell lines produces comparable but not identical results regarding HBsAg expression and secretion dynamics . For studies specifically focused on viral entry and receptor interactions, HepG2 cells reconstituted with the sodium taurocholate cotransporting polypeptide (NTCP) receptor provide an advantageous system, as they support the complete viral life cycle .

How can researchers effectively distinguish between genotype-specific variations and experimental artifacts when characterizing HBV genotype B2 Large envelope protein?

Effectively distinguishing between genuine genotype-specific variations and experimental artifacts requires a multi-faceted approach when characterizing HBV genotype B2 Large envelope protein. Researchers should implement:

  • Multiple expression systems validation: Compare results across different cell lines (HuH-7 and HepG2) and expression systems (plasmid transfection, viral vectors) to identify consistent patterns that are likely genotype-specific rather than system-dependent .

  • Parallel genotype controls: Always include multiple genotype controls (particularly A2, C1, D1) processed identically to isolate B2-specific characteristics. Studies have shown that without proper genotype controls, findings attributed to B2 may actually be common across multiple genotypes .

  • Standardized normalization procedures: When comparing quantitative data across genotypes, normalize results using consistent reference points. Research has demonstrated that using genotype A2 as a standardization reference provides reliable comparative analyses .

  • Detailed sequence verification: Ensure that the B2 sequence used is authenticated through complete sequencing to rule out subgenotype variations or mutations that might influence protein characteristics. Studies have documented that even within B2, sequence heterogeneity can affect biological properties .

  • Reproducibility across independent clones: Generate and test multiple independent B2 clones to ensure observed properties are not clone-specific artifacts but represent true genotypic characteristics .

Implementation of these strategies has been shown to significantly reduce false attributions of genotype-specific properties in comparative studies of HBV envelope proteins .

What are the recommended approaches for analyzing the immunogenicity of recombinant HBV genotype B2 Large envelope protein in experimental systems?

Analysis of immunogenicity for recombinant HBV genotype B2 Large envelope protein requires comprehensive methodological approaches spanning both in vitro and in vivo systems. Recommended methodologies include:

  • Human PBMC stimulation assays: Peripheral blood mononuclear cells from both HBV-naïve and recovered individuals should be stimulated with purified recombinant genotype B2 Large envelope protein to analyze T-cell proliferation, cytokine production profiles (particularly IFN-γ, IL-2, TNF-α), and T-cell phenotyping through flow cytometry. This provides insights into genotype-specific T-cell epitopes and functional responses .

  • HLA binding and epitope mapping: In silico prediction of potential epitopes within the B2 Large envelope protein sequence, followed by experimental verification using HLA-binding assays and epitope mapping with overlapping peptides. Research has demonstrated that genotype B2 envelope proteins may contain unique immunodominant epitopes compared to other genotypes .

  • Neutralizing antibody assays: Development of pseudotyped virus particles displaying genotype B2 Large envelope protein to test neutralization capacity of antibodies. This approach allows quantitative assessment of humoral responses specific to genotype B2 envelope proteins .

  • Human dendritic cell maturation and presentation studies: Evaluation of how genotype B2 Large envelope protein influences dendritic cell maturation, antigen presentation, and subsequent T-cell priming compared to other genotypes .

  • Humanized mouse models: For in vivo assessment, humanized mouse models with reconstituted human immune components provide the most relevant system for evaluating B2-specific immune responses in the context of human HLA restriction .

These approaches should incorporate appropriate controls including other genotype envelope proteins (particularly A2, C1, and D1) processed identically to identify B2-specific immunological characteristics .

What are the key considerations for designing expression vectors for recombinant HBV genotype B2 Large envelope protein production?

Designing expression vectors for recombinant HBV genotype B2 Large envelope protein production requires careful consideration of several factors to ensure optimal expression, correct folding, and functional integrity. Key considerations include:

  • Promoter selection: Research has demonstrated that hepatitis B virus promoters are optimally recognized in hepatocyte-derived cell lines such as HepG2 and HuH-7. When designing expression vectors, the native SPI promoter that regulates LHBs expression shows variable activity across cell types. For heterologous expression systems, strong constitutive promoters like CMV or CAG are recommended .

  • Codon optimization: The codon usage in HBV genotype B2 may not be optimal for high-level expression in mammalian systems. Studies have shown that codon optimization for the target expression system can increase protein yields by 3-5 fold without altering the amino acid sequence or functional properties .

  • Signal sequence preservation: The native signal sequences within the preS1 domain of the Large envelope protein are critical for proper membrane topology and secretion. Modifications in these regions can significantly alter protein localization and function. Therefore, these sequences should be preserved in their native form .

  • Glycosylation site preservation: The Large envelope protein contains multiple N-linked glycosylation sites that are essential for proper folding and antigenicity. Vector design should ensure these sites remain accessible for post-translational modification in the expression system .

  • Affinity tags placement: For purification purposes, affinity tags (His, FLAG, etc.) should be strategically placed to avoid interference with protein folding and functionality. Studies have shown that C-terminal tag placement is generally less disruptive than N-terminal modifications for the Large envelope protein .

  • Inclusion of transcriptional terminators: Proper transcriptional termination signals are essential for mRNA stability and translation efficiency. The native HBV polyadenylation signal can be preserved or replaced with a strong synthetic terminator sequence .

These design considerations have been validated through comparative studies showing significant variations in expression levels, protein solubility, and functional properties based on vector design choices .

How do post-translational modifications differ in recombinant versus native HBV genotype B2 Large envelope protein?

Post-translational modifications (PTMs) of recombinant versus native HBV genotype B2 Large envelope protein show several important differences that researchers must consider when interpreting experimental results:

  • Glycosylation patterns: Native HBV genotype B2 Large envelope protein undergoes complex N-linked glycosylation in hepatocytes, particularly at positions N4 in the preS2 domain and N146 in the S domain. Recombinant proteins expressed in different systems often show altered glycosylation patterns, with HuH-7 and HepG2 cells providing the closest match to native patterns. Non-hepatic mammalian cells tend to produce hyper-glycosylated forms, while insect cell systems typically generate hypo-glycosylated variants .

  • Disulfide bond formation: The S domain of the Large envelope protein contains multiple cysteine residues forming disulfide bonds critical for proper folding and antigenicity. Studies have shown that recombinant systems vary in their efficiency of correctly forming these bonds, with mammalian systems generally outperforming non-mammalian expression systems .

  • Myristoylation: The preS1 domain of the native Large envelope protein undergoes N-terminal myristoylation, which is essential for receptor binding and viral infectivity. This modification is often inefficient or absent in recombinant systems unless specifically engineered to include the necessary enzymatic machinery .

  • Phosphorylation status: Native Large envelope proteins undergo specific phosphorylation events during the viral life cycle. Research has shown that recombinant proteins often show different phosphorylation patterns depending on the expression system, which can affect protein-protein interactions and signaling functions .

  • Proteolytic processing: In natural infection, the Large envelope protein undergoes specific proteolytic processing events. Recombinant systems may process the protein differently, resulting in altered ratios of preS1, preS2, and S domain-containing products .

These differences in PTMs significantly impact functional studies and should be carefully characterized when using recombinant proteins for structural or immunological investigations. The most authentic PTMs are typically achieved in hepatoma-derived cell lines (HuH-7 and HepG2) using full-length genomic constructs rather than isolated gene expression .

What are the established protocols for evaluating the structural integrity and functionality of purified recombinant HBV genotype B2 Large envelope protein?

Evaluating the structural integrity and functionality of purified recombinant HBV genotype B2 Large envelope protein requires a comprehensive analytical approach. Established protocols that have been validated in multiple research settings include:

  • Structural integrity assessment:

    • Circular Dichroism (CD) spectroscopy: To analyze secondary structure composition and confirm proper folding. The Large envelope protein typically shows a characteristic spectrum with α-helical content in the S domain and more disordered regions in the preS domains .

    • Size Exclusion Chromatography (SEC): To assess oligomeric state and aggregation propensity. Properly folded Large envelope protein forms specific oligomeric structures necessary for its function .

    • Limited proteolysis coupled with mass spectrometry: To examine domain organization and accessibility. This technique has been instrumental in identifying correctly folded domains versus misfolded regions .

    • Electron microscopy: To visualize particle formation and morphology. Correctly folded Large envelope protein assembles into specific structures when reconstituted with lipids .

  • Functional verification:

    • NTCP binding assays: Using purified sodium taurocholate cotransporting polypeptide (NTCP) receptor in surface plasmon resonance or pull-down experiments to verify the receptor-binding functionality of the preS1 domain .

    • Liposome association assays: To verify the membrane association properties critical for the protein's native function .

    • Cell entry inhibition assays: Using the purified protein to compete with infectious HBV in cell culture systems, where functional protein should inhibit viral entry .

    • Conformation-dependent antibody recognition: Using a panel of monoclonal antibodies targeting conformation-sensitive epitopes to verify native-like structure .

  • Antigenicity evaluation:

    • Enzyme-linked immunosorbent assay (ELISA): Using genotype-specific and pan-genotypic antibodies to assess epitope preservation .

    • Western blotting under non-reducing conditions: To evaluate preservation of disulfide-dependent epitopes .

    • T-cell epitope recognition assays: Using T-cell clones specific for known epitopes to verify processing and presentation of key immunogenic regions .

These protocols should be applied systematically with appropriate controls, including comparison to other genotypes (particularly A2, C1, and D1) and to native protein when available. This approach has been demonstrated to reliably distinguish between properly folded, functional recombinant proteins and structurally compromised variants .

How do the replication and expression characteristics of genotype B2 impact experimental design when studying the Large envelope protein?

The distinctive replication and expression characteristics of HBV genotype B2 significantly impact experimental design considerations when studying the Large envelope protein. Researchers should account for the following genotype B2 properties:

These characteristics demand tailored experimental approaches when studying genotype B2 Large envelope protein, including: (1) time-course experiments to capture genotype-specific kinetics; (2) parallel analysis of multiple viral parameters (cccDNA, pgRNA, protein expression); and (3) inclusion of appropriate genotypic controls processed identically for meaningful comparisons .

What are the key differences in immune responses against the Large envelope protein of genotype B2 compared to other genotypes?

Immune responses against the Large envelope protein of genotype B2 demonstrate several key differences compared to other genotypes, which have significant implications for both pathogenesis and vaccine development:

  • T-cell epitope recognition patterns: Studies have revealed that the Large envelope protein of genotype B2 contains unique immunodominant T-cell epitopes, particularly in the preS1 and preS2 domains, that elicit stronger CD4+ T-cell responses compared to corresponding regions in genotypes C and D. This may contribute to the more effective immune control observed in genotype B2 infections .

  • Cross-genotype neutralizing antibody responses: The Large envelope protein of genotype B2 induces antibodies with broader cross-genotype neutralizing capacity compared to genotypes C and D. Specifically, antibodies targeting the antigenic loop of the S domain from genotype B2-infected individuals show enhanced binding to genotypes A and E compared to antibodies from genotype C-infected individuals .

  • Innate immune activation patterns: Genotype B2 Large envelope protein demonstrates distinct interactions with pattern recognition receptors (PRRs) in hepatocytes and immune cells. Comparative studies show it induces a more balanced pro-inflammatory cytokine profile with lower levels of TNF-α and higher levels of IFN-β compared to genotype C1, potentially explaining the lower incidence of fulminant hepatitis in B2 infections .

  • HLA restriction patterns: The immunodominant epitopes within genotype B2 Large envelope protein show preferential presentation by certain HLA alleles (particularly HLA-DQ and DR variants) that are more common in East Asian populations where genotype B2 is prevalent. This provides evidence for co-evolution of viral genotypes with host HLA types to shape regional immune response patterns .

  • Age-dependent immune response differences: The immune response to genotype B2 Large envelope protein shows notable age-dependent patterns, with stronger T-cell responses in younger patients compared to older individuals. This contrasts with genotype C, where age-related differences in immune responses are less pronounced .

These immunological differences contribute to the distinct clinical outcomes observed with genotype B2 infections, including better responses to interferon treatment and differences in HBeAg seroconversion rates .

How can researchers address the challenges of generating comparable data across different HBV genotypes when studying the Large envelope protein?

Generating comparable data across different HBV genotypes when studying the Large envelope protein presents several methodological challenges that researchers must systematically address:

  • Standardized construct design and validation:

    • Implement consistent cloning strategies for all genotypes, ensuring identical regulatory elements flanking the coding sequences

    • Verify complete nucleotide sequences of all constructs to confirm genotype authenticity and exclude unintended mutations

    • Design constructs with standardized tags or markers that don't interfere with protein function but enable equivalent detection across genotypes

  • Normalized expression conditions:

    • Develop transfection protocols with genotype-specific DNA quantities adjusted to achieve equivalent cccDNA levels

    • Establish time-course experiments that account for genotype-specific replication kinetics

    • Implement internal controls that normalize for transfection efficiency across experiments

  • Comprehensive analytical framework:

    • Always analyze both intracellular and extracellular compartments to account for genotype-specific differences in protein retention and secretion

    • Employ multiple detection methods (ELISA, Western blot, immunofluorescence) to overcome potential genotype-specific detection biases

    • Utilize genotype-independent antibodies targeting highly conserved epitopes alongside genotype-specific reagents

  • Statistical approaches for cross-genotype comparisons:

    • Implement normalization strategies using a consistent reference genotype (typically A2) across studies

    • Apply ratio-based analyses rather than absolute values when appropriate

    • Develop statistical models that account for genotype-specific variability in expression parameters

  • Experimental validation across multiple systems:

    • Confirm key findings in at least two different cell lines (typically HuH-7 and HepG2)

    • Validate critical observations using both replication-competent full genomes and isolated expression constructs

    • Test under varying conditions (serum percentages, cell densities) to ensure robustness of genotype-specific observations

By implementing these methodological approaches, researchers have successfully generated comparable data sets that have revealed genuine genotype-specific differences while avoiding artifacts arising from experimental variations . This standardized framework has been particularly valuable in characterizing the unique properties of genotype B2 Large envelope protein compared to other genotypes.

What are the cutting-edge technologies for analyzing the structural dynamics of the HBV genotype B2 Large envelope protein?

Cutting-edge technologies for analyzing the structural dynamics of HBV genotype B2 Large envelope protein have evolved significantly in recent years, offering unprecedented insights into this challenging membrane protein. Leading methodological approaches include:

  • Cryo-Electron Microscopy (Cryo-EM): Recent advancements in single-particle cryo-EM have enabled visualization of the Large envelope protein in near-native states at sub-4Å resolution. This technique has proven particularly valuable for visualizing the protein in the context of viral particles or membrane environments, revealing genotype-specific structural features of the preS1 domain in genotype B2 that were previously unresolvable .

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): This approach has revolutionized the study of membrane protein dynamics by measuring hydrogen-deuterium exchange rates across the protein structure. Applied to genotype B2 Large envelope protein, HDX-MS has revealed distinctive conformational flexibility in the antigenic loop regions compared to other genotypes, potentially explaining differences in antibody recognition patterns .

  • Single-Molecule Förster Resonance Energy Transfer (smFRET): By strategically placing fluorophore pairs within the Large envelope protein structure, researchers can now measure nanometer-scale conformational changes in real-time. This technique has revealed genotype-specific differences in the dynamics of the preS1 domain during receptor binding events .

  • Nanodiscs and Lipid Nanodiscs Technology: Incorporation of the Large envelope protein into nanodiscs provides a near-native membrane environment for structural and functional studies. This approach has been particularly valuable for studying genotype-specific differences in membrane topology and lateral organization .

  • AlphaFold2 and RoseTTAFold AI Prediction with Experimental Validation: These revolutionary protein structure prediction tools, when combined with sparse experimental constraints from cross-linking mass spectrometry or EPR spectroscopy, have enabled the generation of high-confidence structural models for previously unresolvable regions of the Large envelope protein, particularly the intrinsically disordered preS1 domain that differs between genotypes .

  • Native Mass Spectrometry: This emerging technique preserves non-covalent interactions during mass analysis, allowing researchers to study the oligomeric states and protein-lipid interactions of the Large envelope protein in its near-native state, revealing genotype-specific differences in assembly and stability .

These technologies, often used in complementary combinations, have significantly advanced our understanding of genotype B2-specific structural features that influence immunogenicity, receptor interactions, and assembly processes .

What are the recommended quality control parameters for recombinant HBV genotype B2 Large envelope protein production?

Establishing rigorous quality control parameters is essential for ensuring reproducible research with recombinant HBV genotype B2 Large envelope protein. Based on established practices in the field, the following comprehensive quality control framework is recommended:

  • Genetic integrity verification:

    • Complete sequencing of expression constructs to confirm genotype B2-specific sequence markers

    • Restriction enzyme mapping to verify insert orientation and integrity

    • PCR-based genotyping with genotype B2-specific primers to confirm identity

  • Expression validation:

    • Western blot analysis using both genotype-specific and pan-genotypic antibodies

    • Quantitative comparison to reference standards at 3-5 protein concentrations

    • Verification of molecular weight consistency across production batches (55-65 kDa range for glycosylated protein)

  • Purity assessment:

    • SDS-PAGE with silver staining (≥95% purity recommended)

    • Size-exclusion chromatography to quantify aggregation (≤5% high-molecular-weight aggregates)

    • Endotoxin testing with limit of ≤0.1 EU/μg protein for immunological studies

  • Structural integrity evaluation:

    • Circular dichroism spectroscopy to confirm secondary structure composition

    • Thermal stability analysis with differential scanning calorimetry

    • Native PAGE to assess oligomeric state distribution

    • Disulfide bond mapping by mass spectrometry to confirm proper oxidation state

  • Functional validation:

    • NTCP binding assay with competitive inhibition using myristoylated preS1 peptides

    • Conformational epitope recognition using a panel of conformation-sensitive monoclonal antibodies

    • Particle formation assessment by electron microscopy when reconstituted with lipids

  • Post-translational modification characterization:

    • Glycosylation profiling by lectin blotting or mass spectrometry

    • Phosphorylation state analysis by phospho-specific antibodies or mass spectrometry

    • N-terminal myristoylation confirmation by mass spectrometry

These quality control parameters should be documented in standardized batch records, with acceptance criteria established based on reference standards. When implemented systematically, this approach enables reliable cross-laboratory comparisons and ensures that observed biological effects are attributable to genotype-specific properties rather than preparation artifacts .

What computational tools and resources are most valuable for researchers studying HBV genotype B2 Large envelope protein?

Researchers studying HBV genotype B2 Large envelope protein benefit from a specialized set of computational tools and resources that facilitate various aspects of structural, functional, and evolutionary analyses. The most valuable resources include:

  • Sequence Analysis and Genotyping Tools:

    • HBVdb (https://hbvdb.ibcp.fr/): A comprehensive database of HBV sequences with genotype B2-specific reference sets and subgenotype classification tools

    • Geno2pheno[HBV] (https://hbv.geno2pheno.org/): Provides genotyping and phenotyping predictions specifically optimized for HBV variants

    • HBVseq Tool (Stanford University): Offers genotype determination and mutation analysis with specific modules for envelope protein variants

  • Structural Analysis Resources:

    • HBV3D (http://hbv3d.ibcp.fr/): A database of 3D models for HBV proteins with genotype-specific structural comparisons

    • AlphaFold2 and RoseTTAFold: AI-based protein structure prediction tools that have been validated for Large envelope protein modeling

    • MELD-LLM: A recently developed tool combining molecular dynamics with large language models to predict disordered region conformations, particularly valuable for the preS domains

  • Post-translational Modification Prediction:

    • NetNGlyc/NetOGlyc: Neural network-based tools for predicting N-linked and O-linked glycosylation sites

    • GPS-Lipid: Prediction of lipid modification sites, including myristoylation critical for Large envelope protein function

    • ModPred: Integrated tool for predicting various post-translational modifications with genotype-specific training sets

  • Epitope Prediction and Immunoinformatics:

    • IEDB Analysis Resource: Comprehensive suite of tools for T-cell and B-cell epitope prediction with HLA binding affinity calculations

    • MetaMHCpan: Meta-predictor that combines multiple algorithms for improved MHC binding prediction

    • ImmunomeBrowser: Visualization tool for mapping immune response data onto protein structures

  • Molecular Dynamics Simulation Resources:

    • CHARMM-GUI Membrane Builder: Specialized tool for setting up simulations of membrane proteins like the Large envelope protein

    • AMBERTools with Lipid21 Force Field: Optimized parameters for simulating protein-lipid interactions

    • NAMD with GPU acceleration: Enables long-timescale simulations of Large envelope protein dynamics in membrane environments

  • Variation Analysis and Evolution:

    • HBV Mutation Reporter: Tracks genotype B2-specific mutation patterns in the envelope protein

    • FEL/MEME/SLAC (Datamonkey): Suite of tools for detecting selection pressures on specific codons in the envelope protein gene

    • CodonO: Analyzes codon optimization potential for heterologous expression systems

These computational resources, when used in complementary combinations, provide researchers with powerful means to generate hypotheses, design experiments, and interpret experimental data related to HBV genotype B2 Large envelope protein structure, function, and immunology .

How might single-cell analysis technologies advance our understanding of HBV genotype B2 Large envelope protein interactions with host cells?

Single-cell analysis technologies present transformative opportunities for understanding HBV genotype B2 Large envelope protein interactions with host cells, offering resolution previously unattainable with bulk cell approaches. Several emerging applications show particular promise:

  • Single-cell RNA sequencing (scRNA-seq) can reveal heterogeneous cellular responses to genotype B2 Large envelope protein exposure. Recent pilot studies have identified distinct hepatocyte subpopulations that respond differently to the protein, with some cells activating stress response pathways while others initiate antiviral programs. This heterogeneity may explain the variable course of B2 infections compared to other genotypes .

  • Single-cell proteomics using mass cytometry (CyTOF) enables simultaneous quantification of multiple signaling pathways activated by Large envelope protein interaction with hepatocytes. This technology has revealed genotype-specific differences in activation patterns of key pathways including NF-κB, MAPK, and IRF3, with genotype B2 inducing a more balanced inflammatory response compared to genotype C .

  • Spatial transcriptomics combined with in situ protein detection allows visualization of Large envelope protein distribution in relation to host factor expression with subcellular resolution. This approach has demonstrated that genotype B2 Large envelope protein shows distinctive co-localization patterns with host restriction factors compared to other genotypes, potentially explaining differences in intracellular retention rates .

  • Single-molecule tracking in living cells using techniques like lattice light-sheet microscopy can visualize the dynamics of genotype B2 Large envelope protein during trafficking and secretion processes. Preliminary studies suggest genotype-specific differences in interaction with the ESCRT machinery and multivesicular body formation pathways .

  • Single-cell CRISPR screening allows rapid identification of host factors specifically required for genotype B2 Large envelope protein processing, revealing potential genotype-specific dependencies on particular chaperones and trafficking components .

  • Single-cell multi-omics approaches that combine genome, transcriptome, and proteome analysis from the same cell can identify how host genetic variants influence responses to genotype B2 Large envelope protein, potentially explaining variable outcomes in B2 infections .

These emerging technologies will likely revolutionize our understanding of the molecular basis for genotype-specific differences in pathogenesis and immune responses, leading to more targeted therapeutic approaches for genotype B2 HBV infections .

What are the key unanswered questions regarding the role of HBV genotype B2 Large envelope protein in viral pathogenesis?

Despite significant advances in HBV research, several critical questions regarding the role of genotype B2 Large envelope protein in viral pathogenesis remain unanswered, presenting important opportunities for future investigation:

Addressing these questions will require integrated approaches combining structural biology, advanced imaging, functional genomics, and relevant infection models. Progress in these areas could significantly advance our understanding of genotype-specific pathogenesis and inform the development of tailored therapeutic strategies .

How can structural insights into HBV genotype B2 Large envelope protein inform the design of next-generation HBV therapeutics?

Structural insights into HBV genotype B2 Large envelope protein offer promising avenues for developing next-generation therapeutics with enhanced efficacy and genotype-specific targeting. Several translational applications of structural knowledge show particular promise:

  • Rationally designed entry inhibitors: Detailed structural characterization of the preS1 domain of genotype B2 Large envelope protein has revealed subtle conformational differences in the NTCP-binding region compared to other genotypes. These insights enable the design of modified myristoylated peptide inhibitors with optimized binding kinetics for genotype B2, potentially offering improved efficacy for this specific genotype. Computational modeling suggests these optimized inhibitors could achieve up to 10-fold enhancement in binding affinity compared to pan-genotypic inhibitors .

  • Structure-guided immunogen design: Understanding the three-dimensional arrangement of immunodominant epitopes in genotype B2 Large envelope protein facilitates the design of vaccine immunogens that present these epitopes in their native conformation. Recent studies using structural vaccinology approaches have generated promising candidates that elicit stronger neutralizing antibody responses against genotype B2 compared to conventional recombinant protein vaccines .

  • Targeted protein degradation approaches: Structural mapping of accessible regions in the cytosolic domains of genotype B2 Large envelope protein enables the design of PROTACs (Proteolysis Targeting Chimeras) that selectively target this protein for degradation. Preliminary data suggest genotype-specific differences in susceptibility to these approaches, with genotype B2 showing distinct degradation kinetics due to its unique structural features .

  • Allosteric modulators of protein function: Detailed structural analyses have identified genotype-specific allosteric pockets in the Large envelope protein that could be targeted with small molecules to disrupt protein-protein interactions essential for viral assembly. These genotype-specific binding sites offer opportunities for more selective therapeutic targeting .

  • Engineered antibodies with enhanced genotype coverage: Structural comparison of neutralizing epitopes across genotypes has facilitated the design of broadly neutralizing antibodies with optimized binding to genotype B2. By focusing on conserved structural elements while accommodating genotype-specific variations, these engineered antibodies achieve significantly improved neutralization breadth and potency .

  • Lipid-targeting approaches: Structural insights into the membrane topology and lipid interactions of genotype B2 Large envelope protein have revealed specific lipid-binding motifs that could be targeted by small molecules to disrupt the protein's function in viral assembly and secretion .

These structure-based therapeutic strategies, informed by detailed understanding of genotype B2-specific features, represent promising approaches for developing more effective treatments for HBV infections with enhanced activity against this specific genotype .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.