Recombinant Hepatitis B virus genotype B/C subtype adw Large envelope protein (S)

Shipped with Ice Packs
In Stock

Description

Definition and Structure

The large envelope protein (LHBs) is a 400-amino-acid glycoprotein encoded by the HBV S gene. It spans the preS1, preS2, and S regions, forming the viral envelope and mediating host cell entry. In genotype B/C subtype adw, this protein is characterized by specific antigenic determinants and structural features linked to viral tropism and infectivity .

Key Structural Features:

FeatureDescription
Expression SystemProduced in E. coli or Baculovirus systems with N-terminal His-tags
Purity>85–90% as determined by SDS-PAGE
Molecular Weight~44 kDa (full-length mature protein)
Antigenic RegionsIncludes preS1, preS2, and S domains critical for receptor binding

Production and Functional Characteristics

Recombinant LHBs (genotype B/C adw) is engineered to retain functional domains for research:

Production Methods:

ParameterDetails
Host SystemsE. coli (His-tagged), Baculovirus, or mammalian cells
Post-ProductionLyophilized or liquid formulations with Tris/PBS buffer and trehalose
StabilityStable at −20°C/−80°C; avoid repeated freeze-thaw cycles

Functional Roles in HBV Life Cycle:

  • Viral Entry: Mediates attachment to host receptors (e.g., NTCP) via preS1 domain .

  • Virion Morphogenesis: Interacts with nucleocapsid to facilitate assembly .

  • Immune Evasion: Modulates host immune responses to promote chronic infection .

Research Applications

The recombinant LHBs (B/C adw) is pivotal in advancing HBV research:

Therapeutic Targeting

Monoclonal antibodies (mAbs) targeting preS1 and preS2 regions of LHBs are under development for neutralizing HBV entry . These mAbs leverage the conserved nature of LHBs across genotypes, including B/C adw .

Key Findings:

Study FocusOutcome
PreS1 DomainCritical for viral entry; mAbs targeting this region block infection
Genotype-SpecificityN-terminal preS1 sequences influence replication and infectivity

Genotype-Specific Pathogenesis

Genotypes B and C are prevalent in Asia-Pacific regions and exhibit distinct pathogenic profiles:

Comparison of HBV Genotypes:

GenotypeReplication CapacityHBeAg Seroconversion RatePre-S Mutations
AModerateHighLow
BModerateEarlierLower
CHighLaterHigher
DHighLaterHigher
B/C adwModerate-HighVariableIntermediate

Data synthesized from clinical studies .

Mechanistic Insights:

  • PreS1 N-Terminus: Genotype-dependent variations alter HBV secretion and infectivity. For example, adw-associated preS1 sequences may enhance virion release compared to other subtypes .

  • Core Promoter Mutations: BCP A1762T/G1764A variants in genotype C increase intracellular HBV DNA accumulation, linked to severe liver disease .

Challenges and Future Directions

While recombinant LHBs (B/C adw) has advanced HBV research, challenges remain:

  • Structural Complexity: Full-length LHBs is challenging to express in functional form, requiring optimized E. coli or mammalian systems .

  • Genotypic Diversity: PreS1 polymorphisms in B/C adw may impact antibody efficacy, necessitating broad-spectrum mAbs .

Emerging Applications:

  • Vaccine Development: Incorporating LHBs into vaccines to broaden protection beyond SHBs-based immunization .

  • Biomarker Discovery: PreS deletions or mutations in LHBs correlate with hepatocellular carcinoma (HCC) risk, enabling early screening .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please contact us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquotting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
S; Large envelope protein; L glycoprotein; L-HBsAg; LHB; Large S protein; Large surface protein; Major surface antigen
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-389
Protein Length
Full Length of Mature Protein
Species
Hepatitis B virus genotype B/C subtype adw (isolate Okinawa/pODW282/1998) (HBV-B)
Target Names
S
Target Protein Sequence
GTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPNKDNWPDANKVGVGAFGPGFTPPHG GLLGWSPQAQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ DPGVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAG FFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLR RFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCC CTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMI WFWGPSLYNILSPFMPLLPIFFCLWVYI
Uniprot No.

Target Background

Function
The large envelope protein exists in two topological conformations: 'external' or Le-HBsAg and 'internal' or Li-HBsAg. In its external conformation, the protein attaches the virus to cell receptors, initiating infection. This interaction determines species specificity and liver tropism. This attachment induces virion internalization primarily through caveolin-mediated endocytosis. The large envelope protein also facilitates fusion between the virion membrane and endosomal membrane. In its internal conformation, the protein plays a role in virion morphogenesis and mediates contact with the nucleocapsid, acting like a matrix protein. The middle envelope protein plays a crucial role in virion budding. It is involved in the induction of budding independent of the nucleocapsid. This process primarily leads to the formation of 22 nm diameter subviral lipoprotein particles that lack a nucleocapsid.
Protein Families
Orthohepadnavirus major surface antigen family
Subcellular Location
Virion membrane.

Q&A

What is the structural composition of HBV envelope proteins, particularly in genotype B/C subtype adw?

HBV envelope proteins consist of three related surface proteins: the small (S), middle (M), and large (L) proteins, all of which contain the same C-terminal S domain. In genotype B/C subtype adw, these proteins have specific amino acid residues at positions 122 (K), 160 (K), and 127 (P) that define the "adw" serological subtype . The S protein forms the basic structural component, while the L protein contains additional N-terminal PreS1 and PreS2 domains essential for viral infectivity .

The adw subtype is characterized by specific conformational epitopes that can be recognized by monoclonal antibodies such as MoMab, which targets correctly folded HBs proteins on the cell surface . These envelope proteins become embedded in both endosomal membranes and the plasma membrane, maintaining their conformational integrity, which is crucial for their immunogenic properties .

How are recombinant HBV surface antigens produced for research applications?

Recombinant HBV surface antigens are typically produced using eukaryotic expression systems, with Saccharomyces cerevisiae being the most common host organism . The production process involves:

  • Cloning of the HBV S gene (with or without PreS regions) into appropriate expression vectors

  • Transformation of S. cerevisiae with the expression construct

  • Induction of protein expression under controlled conditions

  • Purification via multi-step processes including:

    • Ionic exchange chromatography

    • Size exclusion chromatography

    • Sterile filtration

The resulting purified recombinant HBsAg particles are morphologically and antigenically similar to the non-infectious 22nm particles found in the serum of HBV-infected individuals. For research applications requiring high purity, additional steps such as density gradient ultracentrifugation may be employed to enhance preparation homogeneity .

What are the genotypic and subgenotypic classifications of HBV, and how does subtype adw relate to these classifications?

HBV is classified into at least eight genotypes (A-H) based on >8% sequence divergence in the entire genome. Within these genotypes, subgenotypes (e.g., C1-C6) are defined by 4-8% sequence divergence . Separately, HBV is classified into serological subtypes based on antigenic determinants of the HBsAg, including adw, ayw, adr, and ayr.

The relationship between genotypes/subgenotypes and subtypes is as follows:

GenotypeCommon SubtypesGeographic Distribution
Badw2, adw3East Asia, Southeast Asia
Cadrq+, adrq-, adwEast Asia, Southeast Asia, Pacific Islands

Interestingly, research in Papua, Indonesia identified unique HBV/C isolates with a different amino acid combination (A159/A177) that differs from both adrq+ (V159/V177) and adrq- (V159/A177), provisionally termed "adrq indeterminate" . This highlights the ongoing discovery of novel variants and the complexity of HBV classification systems.

What are the most effective methods for isolating and characterizing HBV-neutralizing monoclonal antibodies against the envelope proteins?

Recent advances in antibody isolation techniques have yielded highly effective methods for developing HBV-neutralizing monoclonal antibodies. Based on current research, a comprehensive approach includes:

  • Source selection and preparation:

    • Identify suitable donors with high anti-HBs titers, preferably those who have received booster vaccinations to enhance antibody affinity and specificity

    • Isolate peripheral blood mononuclear cells (PBMCs) via density gradient centrifugation

  • B cell isolation strategies:

    • Epstein-Barr virus (EBV) hybridoma method: Transform B cells with EBV to create immortalized cell lines

    • Antigen-specific memory B cell sorting: Use fluorescently labeled HBsAg to isolate antigen-specific B cells via flow cytometry

  • Antibody cloning and expression:

    • Clone cDNAs of both heavy and light chains from isolated B cells

    • Insert into IgG1 expression vectors

    • Transfect into expression systems such as Expi293F cells

  • Screening and characterization workflow:

    • ELISA-based initial screening for binding to recombinant HBsAg

    • In vitro HBV neutralization assays using HepG2-NTCP cells

    • Cross-reactivity testing against human proteins to ensure specificity

    • Epitope mapping to identify binding sites on HBsAg

This approach has successfully yielded monoclonal antibodies with neutralizing activity exceeding that of commercially available HBIG preparations .

How can researchers effectively study the interaction between HBV envelope proteins and host cell receptors in different experimental systems?

Studying HBV envelope protein interactions with host cell receptors requires a multi-faceted approach:

  • Cell culture systems:

    • HepG2-NTCP cells: Express the NTCP receptor essential for HBV entry

    • Primary human hepatocytes (PHH): Provide the most physiologically relevant model

    • HepaRG cells: Differentiated hepatocyte-like cells permissive to HBV infection

  • Protein-protein interaction assays:

    • Co-immunoprecipitation of viral envelope proteins with host receptors

    • Surface plasmon resonance to determine binding kinetics

    • Proximity ligation assays to visualize interactions in situ

  • Visualization techniques:

    • Superparamagnetic iron oxide nanoparticles coated with HBs-specific antibodies can detect membrane-associated HBs by electron microscopy

    • Confocal microscopy with fluorescently-tagged antibodies against conformational epitopes of HBsAg

    • Live-cell imaging to track viral entry in real-time

  • Functional assays:

    • Entry inhibition assays using receptor-blocking antibodies

    • Mutagenesis of PreS1 domain to identify receptor-binding residues

    • CRISPR-based knockout of candidate receptors to confirm their roles

These approaches have revealed that the envelope proteins, particularly the PreS1 domain of the L protein, interact with the bile acid transporter sodium/taurocholate co-transporting polypeptide (NTCP) on hepatocytes , which serves as the primary receptor for HBV entry.

What experimental approaches are most suitable for evaluating the immunogenicity of recombinant HBV envelope proteins of different genotypes and subtypes?

Evaluating immunogenicity of recombinant HBV envelope proteins requires comprehensive approaches covering both humoral and cellular immune responses:

  • In vitro antibody response assessment:

    • Neutralization assays using HBV infection systems

    • Epitope mapping using peptide arrays or phage display libraries

    • Competitive binding assays with characterized neutralizing antibodies

    • Affinity measurements using bio-layer interferometry or surface plasmon resonance

  • Cellular immunity evaluation:

    • T-cell proliferation assays in response to antigen stimulation

    • Cytokine profiling (IFN-γ, IL-2, TNF-α) using ELISpot or intracellular cytokine staining

    • HLA-tetramer staining to quantify antigen-specific T cells

    • In vitro redirected T-cell cytotoxicity using bispecific antibodies or chimeric antigen receptors

  • Animal model studies:

    • Immunization protocols in genetically humanized mice expressing human HLA molecules

    • Challenge studies in human-liver chimeric mice (e.g., FRG mice with humanized livers)

    • Comparative analysis of antibody titers against different genotypes/subtypes

  • Correlative measurements:

    • Quantification of anti-HBs antibody titers (with 10 IU/L considered protective)

    • B and T cell memory development assessment

    • Cross-reactivity against heterologous genotypes/subtypes

These approaches have demonstrated that recombinant HBV envelope proteins can induce robust immune responses, with over 90% of healthy adults, children, and neonates developing protective anti-HBs titers following vaccination with recombinant HBsAg .

How can recombinant HBV envelope proteins be utilized in developing novel therapeutic strategies beyond vaccination?

Recombinant HBV envelope proteins offer several promising therapeutic applications beyond traditional vaccination:

  • Immunotherapeutic approaches:

    • Development of T-cell engager bispecific antibodies that recognize HBs on infected cell surfaces and recruit cytotoxic T-cells

    • Engineering of chimeric antigen receptors (CARs) targeting HBs for adoptive T-cell therapy

    • Therapeutic vaccination strategies to boost immune responses in chronically infected patients

  • Targeted drug delivery systems:

    • HBs-specific antibody-drug conjugates to deliver cytotoxic payloads to infected cells

    • Nanoparticle formulations with HBs-targeting moieties for hepatocyte-specific delivery

    • PreS1-derived peptides conjugated to nucleic acid-based therapeutics for receptor-mediated entry

  • Diagnostic and imaging applications:

    • Development of sensitive detection systems using recombinant antibodies against conformational epitopes

    • Superparamagnetic iron oxide nanoparticles coated with HBs-specific antibodies for imaging HBV-infected cells

    • Monitoring tools for evaluating therapeutic efficacy in clinical trials

  • Combination therapeutic strategies:

    • Dual-targeting approaches combining envelope protein targeting with viral replication inhibitors

    • Synergistic combinations with immunomodulators to enhance clearance of infected cells

Research has demonstrated that HBs proteins remain correctly folded when expressed on the cell surface, making them accessible targets for immunotherapeutic approaches both in vitro and in vivo .

What are the critical factors affecting the successful repair of HBV DNA genome and establishment of persistent infection, and how might these be targeted?

HBV persistence depends on successful repair of its DNA genome within host cells. Research has identified five critical cellular factors required for this process:

  • Key repair factors identified:

    • DNA polymerase delta: Essential for filling gaps in the viral genome

    • Additional factors: Four other cellular proteins work in concert with polymerase delta

  • Repair process vulnerabilities:

    • The repair process can be inhibited by targeting DNA polymerase delta with aphidicolin

    • Inhibition prevents completion of the HBV genome repair both in vitro and in infected liver cells

    • All five identified factors are necessary; removing any one prevents successful repair

  • Targeting strategies:

    • Small molecule inhibitors of specific repair factors

    • CRISPR-based disruption of repair factor expression

    • Allosteric modulators affecting repair factor interactions

    • RNA interference to reduce expression of critical repair proteins

  • Combination approaches:

    • Simultaneous targeting of multiple repair factors

    • Sequential inhibition at different stages of the viral lifecycle

    • Complementary targeting of both viral and host factors

Research at Princeton University demonstrated that inhibiting DNA polymerase delta with aphidicolin effectively prevents HBV infection establishment, providing proof-of-concept for this therapeutic approach . Recent work (2025) from Weill Cornell Medicine, Memorial Sloan Kettering Cancer Center, and The Rockefeller University has identified additional vulnerabilities in this process that could lead to new treatment options .

How do genetic variations in HBV envelope proteins across different genotypes and subtypes impact neutralization efficacy of therapeutic antibodies?

Genetic variations in HBV envelope proteins significantly influence antibody neutralization efficacy:

  • Genomic and antigenic diversity:

    • Eight major genotypes (A-H) show >8% sequence divergence across the genome

    • Subgenotypes within each genotype exhibit 4-8% sequence divergence

    • Serological subtypes (adw, ayw, adr, ayr) reflect variations in the antigenic determinants

  • Impact on neutralizing epitopes:

    • Key neutralizing epitopes in the "a" determinant (amino acids 124-147) may be altered by mutations

    • Some mutations occur naturally in different genotypes and subtypes

    • Vaccine/immunoglobulin escape mutations often cluster in this region

  • Cross-neutralization data:

    • Analysis of neutralizing antibodies against different HBV variants shows variable efficacy:

    Antibody SourceNeutralization Efficacy (%)
    Genotype B/adw
    Vaccine-induced95-100
    HBIG preparation90-100
    Recombinant mAb95-100

    *Depending on specific epitope targeted

  • Strategies to address variation:

    • Development of broadly neutralizing antibodies targeting conserved conformational epitopes

    • Cocktails of antibodies targeting different epitopes

    • Structure-guided antibody engineering to enhance cross-reactivity

    • Surveillance for emerging escape variants to update antibody therapeutics

Recent research has isolated monoclonal antibodies from vaccinated donors that demonstrate strong neutralizing activity against HBV, with some showing broader cross-reactivity than commercial HBIG preparations . These antibodies bind to conformational epitopes, which may be better conserved across different viral variants than linear epitopes.

What are the current limitations in expressing and purifying conformationally correct recombinant HBV envelope proteins, and how might these be overcome?

Researchers face several challenges in producing conformationally authentic recombinant HBV envelope proteins:

  • Expression system limitations:

    • S. cerevisiae: Commonly used but may introduce non-native glycosylation patterns

    • Mammalian cells: Better glycosylation but lower yield and higher cost

    • Insect cells: Intermediate option with moderate yields and glycosylation fidelity

  • Conformational authenticity challenges:

    • Maintaining native disulfide bonding patterns is critical for conformational epitopes

    • PreS domains are particularly prone to misfolding or inappropriate interaction with expression host proteins

    • Particle assembly may be incomplete or heterogeneous

  • Purification obstacles:

    • Aggregation during purification processes

    • Co-purification of host cell proteins that may affect downstream applications

    • Difficulty separating properly folded from misfolded species

  • Solution strategies:

    • Optimization of redox conditions during expression and purification

    • Addition of molecular chaperones or disulfide isomerase to expression systems

    • Development of conformation-specific affinity purification methods

    • Mild detergent formulations to maintain native membrane protein conformations

    • Directed evolution of expression hosts for improved folding capacity

  • Quality assessment approaches:

    • Conformational antibody binding assays

    • Circular dichroism spectroscopy

    • Limited proteolysis mapping

    • Electron microscopy negative staining to confirm particle morphology

Research has confirmed that properly folded HBs can be detected using conformation-specific antibodies such as MoMab, suggesting that these antibodies could be utilized in purification and quality control processes . Implementation of these strategies can significantly improve the yield of conformationally correct recombinant HBV envelope proteins.

How might evolutionary conservation of HBV envelope proteins inform the development of pan-genotypic therapeutics and vaccines?

Evolutionary insights into HBV envelope proteins provide valuable guidance for developing broadly effective interventions:

  • Conservation analysis findings:

    • Despite millions of years of evolution, key structural elements of HBV proteins remain highly conserved

    • Functional domains critical for viral entry and assembly show greater sequence conservation

    • The "a" determinant contains residues that are invariant across all genotypes

  • Structural biology insights:

    • Cryo-EM and X-ray crystallography studies reveal conserved structural elements

    • Some epitopes maintain conformational similarity despite sequence variation

    • Virus-host protein interaction interfaces tend to be more conserved

  • Therapeutic targeting implications:

    • Conserved regions in PreS1 that interact with NTCP represent prime targets

    • Conformational epitopes may offer better cross-genotype protection than linear epitopes

    • Targeting host factors involved in HBV replication may circumvent viral variation

  • Pan-genotypic vaccine development strategies:

    • Inclusion of multiple genotype sequences in vaccine formulations

    • Focus on highly conserved epitopes for broader protection

    • Structural vaccinology approaches to design immunogens presenting multiple critical epitopes

  • Clinical application opportunities:

    • Development of broadly neutralizing antibodies targeting conserved regions

    • Design of entry inhibitors that block conserved virus-receptor interactions

    • Creation of diagnostic tests with pan-genotypic sensitivity

Research on ACNDV (an HBV-like virus from fish) has shown remarkable structural conservation with human HBV capsid proteins despite 400 million years of evolutionary separation . This suggests that certain structural elements are functionally indispensable and may represent ideal targets for interventions with broad activity across HBV variants.

What emerging technologies show the most promise for studying HBV envelope protein interactions within the viral lifecycle?

Several cutting-edge technologies are revolutionizing the study of HBV envelope proteins:

  • Advanced imaging technologies:

    • Super-resolution microscopy allowing visualization of individual viral particles and their interactions

    • Cryo-electron tomography enabling 3D visualization of virus-host interactions in near-native states

    • Live-cell correlative light and electron microscopy tracking viral proteins from entry to assembly

  • Protein interaction analysis tools:

    • Proximity labeling methods (BioID, APEX) to map the interaction landscape of envelope proteins

    • Crosslinking mass spectrometry to capture transient interactions

    • Single-molecule FRET to study conformational changes during viral entry and assembly

  • Genetic engineering approaches:

    • CRISPR interference/activation screens to identify host factors interacting with envelope proteins

    • Site-specific unnatural amino acid incorporation for precise labeling of viral proteins

    • Cell-free expression systems for studying membrane protein insertion and folding

  • Computational methods:

    • Molecular dynamics simulations of envelope protein interactions with membranes

    • AI-based prediction of protein-protein interaction networks

    • Integrative structural biology combining multiple data sources to model complex assemblies

  • Emerging application examples:

    • Superparamagnetic iron oxide nanoparticles coated with HBs-specific antibodies have successfully visualized membrane-associated HBs in electron microscopy studies

    • Redirected T-cells (using either chimeric antigen receptors or bispecific T-cell engager antibodies) have demonstrated the accessibility of HBs on the surface of infected cells

    • Recent work published in February 2025 has leveraged these advanced approaches to identify a vulnerability in the HBV lifecycle that could be targeted with a compound already in clinical trials for cancer

These technologies are enabling unprecedented insights into the spatial and temporal dynamics of HBV envelope protein interactions throughout the viral lifecycle, accelerating the development of novel therapeutic strategies.

What are the current standards for characterizing recombinant HBV envelope proteins for research applications?

Standardized approaches for characterizing recombinant HBV envelope proteins ensure research reproducibility and reliability:

  • Physicochemical characterization standards:

    • Purity assessment: SDS-PAGE, size exclusion chromatography, and mass spectrometry

    • Particle morphology: Negative stain electron microscopy and dynamic light scattering

    • Thermal stability: Differential scanning calorimetry and thermofluor assays

    • Primary structure verification: LC-MS/MS peptide mapping and N-terminal sequencing

  • Immunological characterization requirements:

    • Antigenicity testing using reference antibodies against conformational and linear epitopes

    • Comparison to international reference standards when available

    • Testing against a panel of genotype-specific antibodies to confirm cross-reactivity

  • Functional characterization approaches:

    • Receptor binding assays (e.g., with recombinant NTCP)

    • Cell entry inhibition assays in susceptible cell lines

    • Assessment of particle assembly and stability

  • Recommended minimum dataset:

    • Complete amino acid sequence with post-translational modifications identified

    • Detailed expression and purification methodology

    • Conformational epitope integrity confirmation

    • Batch-to-batch consistency data

  • Documentation requirements:

    • Certificate of analysis with standardized testing parameters

    • Release specifications based on intended research application

    • Stability data under recommended storage conditions

These standards help ensure that research findings using recombinant HBV envelope proteins are reliable and comparable across different laboratories. While commercial preparations typically undergo more rigorous characterization, research applications should adhere to these core principles to maintain scientific integrity.

How can researchers effectively validate new models and assays for studying HBV envelope protein functions?

Validation of new experimental systems is essential for advancing HBV envelope protein research:

  • Model system validation criteria:

    • Demonstration of physiological relevance (e.g., expression of appropriate receptors)

    • Confirmation of expected viral entry pathways and trafficking

    • Verification of envelope protein localization patterns

    • Correlation with established models or clinical observations

  • Assay validation framework:

    • Specificity: Demonstrated through appropriate controls (e.g., known inhibitors)

    • Sensitivity: Detection limits determined using quantitative standards

    • Reproducibility: Inter- and intra-laboratory variability assessment

    • Dynamic range: Established using dose-response experiments

  • Reference standards and controls:

    • Inclusion of well-characterized reference materials

    • Positive and negative controls specific to the assay

    • Comparison with established methodologies when possible

  • Statistical validation requirements:

    • Power analysis to determine appropriate sample sizes

    • Standard statistical methods appropriate for the specific assay

    • Reporting of both biological and technical replicates

  • Practical validation examples:

    • In vitro HBV neutralization assays can be validated using reference antibodies with known neutralizing activity

    • Cell surface HBs detection methods can be verified using MoMab, which recognizes a conformational epitope on correctly folded HBs

    • Host factor dependency can be confirmed through complementary approaches (e.g., siRNA knockdown and CRISPR knockout)

Implementing these validation practices enhances the reliability and translatability of findings related to HBV envelope protein functions, facilitating more rapid advancement toward effective therapeutic strategies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.