Recombinant Hepatitis B virus genotype C subtype adr Small envelope protein (S)

Shipped with Ice Packs
In Stock

Description

Key Features of Recombinant S Protein

PropertyDetailsSource
Host systemsE. coli, Yeast, Baculovirus, Mammalian cells
Purity≥85% (SDS-PAGE)
Molecular weight~25 kDa (including His-tag in some constructs)
ApplicationsImmunoassays, vaccine development, functional studies

Genotype-Specific Characteristics

HBV genotype C subtype adr is prevalent in Asia and associated with:

  • Delayed HBeAg seroconversion: Compared to genotype B, leading to prolonged viremia .

  • Higher virulence: Linked to increased risks of cirrhosis and hepatocellular carcinoma .

  • Core promoter mutations: A1762T/G1764A mutations enhance replication and worsen clinical outcomes .

Comparative Replication Efficiency

FeatureGenotype C (subtype adr)Genotype B
Replication capacityLower (wild-type strains)Higher
Virion secretionMore efficientLess efficient
HBeAg seroconversion7.9% annual rate15.5% annual rate
Core promoter mutationsFrequent A1762T/G1764ARare
Data derived from .

Research Findings

  • Role in viral secretion:

    • Deletion of S protein eliminates Middle (M) envelope protein expression and reduces intracellular Large (L) protein levels .

    • Truncated S protein variants inhibit subviral particle secretion .

  • Immune evasion: Genotype C’s efficient virion secretion compensates for lower replication, aiding immune evasion .

  • Therapeutic targeting: Monoclonal antibodies targeting Pre-S1 domain of L protein show promise, but S protein remains central to vaccine design .

Production and Applications

Recombinant S protein is produced using multiple systems:

  • Bacterial (E. coli): Cost-effective for large-scale production but lacks post-translational modifications .

  • Mammalian cells: Ensures proper folding and glycosylation, critical for antigenic studies .

Clinical and Research Implications

  • Diagnostics: Used in HBsAg detection kits due to high antigenicity .

  • Vaccine development: Current vaccines use S protein; inclusion of Pre-S regions (from L/M proteins) may improve efficacy .

  • Pathogenesis studies: Genotype C’s delayed HBeAg seroconversion and mutation profile inform personalized therapies .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have any specific format requirements, kindly indicate them during order placement. We will then prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributor for specific delivery time estimates.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure all contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is advisable to add 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
S; Small envelope protein; S glycoprotein; S-HBsAg; SHB; Small S protein; Small surface protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-226
Protein Length
full length protein
Species
Hepatitis B virus genotype C subtype adr (isolate China/NC-1/1988) (HBV-C)
Target Names
S
Target Protein Sequence
MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNH SPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYHGMLPVCPLLPGTSTTSTGP CKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFV QWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
Uniprot No.

Target Background

Function
The large envelope protein exists in two topological conformations: one termed 'external' or Le-HBsAg and the other 'internal' or Li-HBsAg. In its external conformation, the protein attaches the virus to cell receptors, initiating infection. This interaction determines the species specificity and liver tropism. This attachment induces virion internalization primarily through caveolin-mediated endocytosis. The large envelope protein also likely mediates fusion between the virion membrane and endosomal membrane. In its internal conformation, the protein plays a role in virion morphogenesis and mediates contact with the nucleocapsid like a matrix protein. The middle envelope protein plays a crucial role in the budding of the virion. It is involved in the induction of budding in a nucleocapsid-independent way. In this process, the majority of envelope proteins bud to form subviral lipoprotein particles of 22 nm in diameter that do not contain a nucleocapsid.
Protein Families
Orthohepadnavirus major surface antigen family
Subcellular Location
Virion membrane.

Q&A

Basic Research Questions

  • What are the key structural and functional characteristics of the HBV genotype C small envelope protein?

    The small envelope protein (S) is the most abundant of the three HBV envelope proteins (L, M, S). It consists of 226 amino acids and plays a critical role in virus assembly and infection. Structurally, the S protein forms a dimeric building block in subviral particles (SVPs), with cryo-EM studies revealing that each spherical SVP contains approximately 48 S proteins arranged in a rhombicuboctahedron-like surface lattice with 24 protruding spikes . Each spike comprises an asymmetric S protein dimer.

    Functionally, the S protein is essential for virion secretion and contains important epitopes for antibody recognition. It can self-assemble into 22-nm SVPs that lack viral nucleocapsids and exceed virions by >1,000-fold in patient blood . In genotype C specifically, studies have shown more efficient virion secretion compared to other genotypes like B .

  • How does the expression of HBV genotype C compare with other genotypes in experimental systems?

    Comparative studies between genotypes have revealed significant differences in expression patterns:

    Genotypes comparedB versus CA versus D
    Serum HBV DNA levelLower (B)Higher (C)
    Intracellular expression of HBV DNALower (B)Higher (C)
    Secretion of HBeAgLower (B)Higher (C)

    In vitro studies have demonstrated that intracellular expression of HBV DNA was higher for genotype C than B, and genotypes D than A . Furthermore, the secretion of HBeAg in genotype B was lower than in genotype C .

    Research utilizing 1.3-mer clones has shown that genotype C isolates often display more efficient virion secretion, which may compensate for their sometimes lower replication capacity to ensure persistent infection .

  • What experimental systems are most effective for studying HBV genotype C small envelope protein?

    Multiple experimental systems have proven effective for studying HBV S protein:

    SystemAdvantagesLimitationsApplications
    Hepatoma cell lines (Huh7, HepG2)Easy to handle, high transfection efficiencyLack complete viral life cycleStudying virus replication, protein expression
    NTCP-expressing hepatoma cellsCan be infected with HBV, allowing study of initial infection stagesRequires high multiplicity of infection, short-lived infectionTesting entry inhibitors, studying early infection
    Recombinant expression systemsControl over protein sequence, high yieldMay have differences in post-translational modificationsStructural studies, antibody development

    For recombinant expression specifically, mammalian expression systems (such as HEK293 cells) have been shown to produce S-HBsAg VLPs with superior antigenic properties compared to yeast-derived systems . The protein can be accumulated intracellularly, solubilized from membranes, and purified through affinity chromatography, with subsequent maturation using reduced and oxidized Glutathione (GSH/GSSG) at 37°C to fully mature the surface epitopes on the VLPs .

  • What methods can be used to assess the quality and authenticity of recombinant HBV genotype C S protein?

    Multiple complementary techniques provide comprehensive assessment:

    1. Structural analysis:

      • Transmission electron microscopy (TEM) to visualize particle formation and morphology

      • Mass photometry (MP) to evaluate assembly by mass and size

      • Cryo-EM for high-resolution structural determination

    2. Functional and antigenic characterization:

      • Immunoassays using monoclonal antibodies to verify epitope presentation

      • Multiplex serology to compare antigenicity with reference standards

      • Bead-based multiplex technology to assess ability to detect anti-HBs antibodies

    3. Biochemical verification:

      • Western blot analysis to confirm protein size and reactivity

      • ELISA to quantify protein expression levels

      • Analysis of glycosylation patterns and other post-translational modifications

    Studies have shown that mammalian-expressed S-HBsAg VLPs detected anti-HBs antibodies with higher sensitivity and specificity in multiplex serology compared to yeast or serum HBsAg, making them most suitable for analyzing HBV immunity through anti-HBs serostatus .

  • How does the core promoter sequence affect the replication capacity of HBV genotype C?

    The relationship between core promoter sequence and replication is complex and genotype-dependent:

    1. The A1762T/G1764A core promoter mutations are prevalent in genotype C isolates and correlate with increased replication capacity .

    2. Most genotype C isolates with wild-type core promoter sequence replicate less efficiently than corresponding genotype B isolates due to less efficient transcription of the 3.5-kb RNA .

    3. The low intracellular levels of viral DNA and core protein of wild-type genotype C may delay immune clearance and trigger the subsequent emergence of A1762T/G1764A core promoter mutations to upregulate replication .

    4. The efficient virion secretion characteristic of genotype C compensates for the low replication capacity to ensure persistent infection establishment .

    This dynamic interplay between replication capacity, promoter mutations, and virion secretion contributes to the pathogenesis of genotype C infections, which are associated with more severe liver disease progression.

Advanced Research Questions

  • What methodologies can be employed to investigate the dimerization and oligomerization process of HBV genotype C small envelope protein?

    Several complementary approaches can provide insights into S protein oligomerization:

    1. Structural methods:

      • Cryo-EM with 3D reconstruction and segmentation offers direct visualization evidence for identifying the oligomerization state, revealing that SVPs are arranged in a rhombicuboctahedron-like surface lattice with 24 protruding spikes, each composed of an asymmetric S protein dimer .

      • Asymmetric reconstruction can reveal subtle structural details that may be lost with symmetry imposition.

      • Fluorescence correlation spectroscopy, atomic force microscopy (AFM), and biochemical crosslinking have also been used, though with occasionally contradictory results .

    2. Mutagenesis approaches:

      • Site-directed mutagenesis of specific residues at dimer interfaces to disrupt oligomerization.

      • Analysis of naturally occurring mutations that affect assembly.

      • Introduction of reporter tags at strategic positions to monitor conformational changes during assembly .

    3. Biochemical characterization:

      • Size exclusion chromatography to separate different oligomeric states.

      • Chemical crosslinking followed by mass spectrometry to identify interaction interfaces.

      • Native PAGE and analytical ultracentrifugation to determine oligomeric states in solution.

    Recent research has definitively shown that each spherical SVP contains 48 S proteins (24 dimers), which differs significantly from earlier reports suggesting 70-100 copies per particle .

  • How can researchers optimize recombinant HBV genotype C small envelope protein expression for structural and functional studies?

    Optimization strategies should focus on both expression and maturation:

    1. Expression system selection:

      • Mammalian expression systems (particularly HEK293-6E cells) have been shown to produce S-HBsAg with superior antigenic properties compared to yeast systems .

      • Transient gene expression allows for rapid iteration and optimization.

    2. Expression construct design:

      • Codon optimization for the host expression system.

      • Addition of appropriate signal sequences for membrane targeting.

      • Optional inclusion of purification tags that don't interfere with folding.

    3. Culture conditions optimization:

      • Temperature modulation (typically lower temperatures can improve folding).

      • Media supplementation with specific lipids that may facilitate proper membrane protein folding.

      • Induction timing and strength adjustment.

    4. Purification and maturation:

      • Solubilization from membranes using optimized detergent conditions.

      • Affinity chromatography for initial purification.

      • Critical maturation step using NH₄SCN for VLP formation, followed by treatment with reduced and oxidized Glutathione (GSH/GSSG) at 37°C to fully mature surface epitopes .

    5. Quality control:

      • Transmission electron microscopy and mass photometry to verify proper assembly.

      • Functional assays to confirm immunoreactivity.

      • Validation with reference standards.

    This streamlined approach has been shown to generate superior samples with uniform surface presentation of the antigenic loop for both structural analysis and serological applications .

  • What techniques are most effective for comparing the neutralization epitopes of different HBV genotypes' small envelope proteins?

    A multi-faceted approach is optimal for comprehensive epitope comparison:

    1. Multiplex immunoassays:

      • Using panels of fluorescently identified beads, each conjugated to different anti-HBs antibodies, followed by detection with polyclonal phycoerythrin-conjugated antibodies .

      • HBsAg multiplex panels utilizing 19 monoclonal antibodies directed against HBsAg "a" determinant and C-terminal domain epitopes spanning residues 99-226 .

      • Normalization to reference standards (such as A2 adw2 vaccine strain) for consistent comparison .

    2. Competitive binding assays:

      • Using labeled reference antibodies to quantify binding competition.

      • Systematic mapping of binding regions through competition analysis.

    3. Neutralization assays:

      • Using HepaRG or HepG2-NTCP cell systems to measure neutralizing capacity of antibodies.

      • Comparison of neutralization efficacy across genotypes can reveal functional epitope differences.

      • Development of monoclonal antibodies (like G12) that recognize conformational epitopes across multiple genotypes .

    4. In silico structural analysis:

      • Molecular modeling of envelope proteins from different genotypes.

      • Identification of structural variations in antigenic regions.

      • Prediction of antibody binding sites based on structural data.

    Research has shown that human monoclonal antibodies can be developed that react with envelope proteins of multiple HBV genotypes (A-F, H) through immunofluorescent staining, and neutralize HBV infectivity in both HepaRG and HepG2-NTCP cell systems .

  • What are the most sensitive techniques for detecting differences in virion assembly and secretion between HBV genotype C and other genotypes?

    Detecting subtle differences requires sophisticated techniques:

    1. Quantitative analysis of viral components:

      • Southern blotting using probes that equally detect all genotypes to measure replicative DNA levels .

      • Plasmid dilution controls to verify equal probe binding affinity across genotypes .

      • Western blotting with genotype-specific and pan-genotypic antibodies to compare protein expression levels .

      • Real-time PCR to quantify viral RNA transcripts from different promoters .

    2. Virion secretion analysis:

      • Immunoprecipitation of virions from supernatants to exclude unenveloped nucleocapsids .

      • Density gradient ultracentrifugation to separate different viral particles.

      • Electron microscopy to examine particle morphology.

    3. Infection models:

      • Comparison of infection efficiency in NTCP-expressing cell lines.

      • Analysis of cccDNA formation after infection with different genotypes.

      • Measurement of spread kinetics within cell cultures.

    4. Promoter activity measurements:

      • Luciferase reporter assays to compare activity of major upstream regulatory regions across genotypes .

      • Site-directed mutagenesis to identify specific sequence elements responsible for differences.

    Research has demonstrated that sequence differences in the major upstream regulatory region across genotypes impact promoter activity, which contributes to differences in viral replication capacity and protein expression . Additionally, studies using 1.3-mer clones have shown striking differences in HBV replicative capacity and HBeAg and HBsAg protein expression across genotypes .

  • How can researchers best investigate the role of HBV genotype C small envelope protein in hepatocellular carcinoma development?

    A multi-dimensional research approach should be employed:

    1. In vitro tumor promotion studies:

      • Force expression of SHBs in HCC cells and measure effects on proliferation, migration, and invasion.

      • Xenograft tumor growth models to assess how SHBs affects tumor development in vivo .

      • Analysis of microvessel density (MVD) within tumors to evaluate angiogenic effects .

    2. Signaling pathway analysis:

      • Investigation of unfolded protein response (UPR) sensors activation (IRE1α, PERK, and ATF6) associated with ER stress .

      • Analysis of VEGFA expression and secretion in response to SHBs expression .

      • Examination of downstream signaling cascades affected by S protein.

    3. Clinical correlation studies:

      • Correlation of HBsAg levels with MVD counts in HCC patient specimens .

      • Comparison of HBsAg-positive vs. negative HCC tissues for VEGFA expression .

      • Analysis of genotype-specific mutations in S protein and their association with HCC risk.

    4. Host-virus interaction studies:

      • Investigation of S protein interactions with host factors using techniques like proximity labeling.

      • Identification of cellular pathways disrupted by S protein.

      • Examination of immune evasion mechanisms mediated by S protein.

    Research has demonstrated that forced expression of SHBs in HCC cells promotes xenograft tumor growth and increases microvessel density within tumors . HBsAg positivity correlates with MVD counts in HCC patient specimens, and SHBs increases VEGFA expression at both mRNA and protein levels, promoting angiogenesis through ER stress-related pathways . These findings suggest an important role for SHBs in HCC development and highlight potential targets for therapeutic intervention.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.