Recombinant Hepatitis B virus genotype D Large envelope protein (S)

Shipped with Ice Packs
In Stock

Description

Molecular Structure and Characteristics

The L-HBsAg is a transmembrane protein comprising three domains: preS1 (residues 1–108 for genotype D), preS2 (55 residues), and S (226 residues) . Key features include:

PropertyDetails
Molecular Weight43.5–44.1 kDa (theoretical)
Amino Acid Sequence389 residues (positions 2–389)
Post-translational ModsN-terminal myristoylation (critical for infectivity)
TopologyDual conformation: external (Le-HBsAg) for receptor binding, internal (Li-HBsAg) for morphogenesis

Genotype D’s preS1 domain is distinct, with a truncated N-terminus (3 residues) , contributing to enhanced infectivity compared to genotypes A–C .

Production and Purification

Recombinant L-HBsAg is typically expressed in E. coli systems, achieving >85% purity via SDS-PAGE . Key parameters include:

  • Expression System: In vitro E. coli

  • Tag: N-terminal 6xHis for affinity purification

  • Storage: -20°C in Tris/PBS buffer with 5–50% glycerol

Viral Entry and Infectivity

  • The preS1 domain mediates HBV binding to hepatocyte receptor NTCP .

  • Genotype D’s preS1 N-terminus enhances infectivity due to optimized myristoylation and hydrophobicity .

  • Deletions in preS2 (e.g., residues 18–22) reduce virion secretion but retain infectivity .

Antibody Neutralization

  • Anti-preS2 antibodies neutralize HBV by targeting epitopes on both L and M proteins .

  • Mutations in the preS2 matrix domain (e.g., Δ18–22) escape neutralization by antibodies like 3E6 mAb .

Subgenotype Variability

  • Subgenotypes D1–D5 exhibit divergent clinical outcomes:

    • D2/D3: Associated with hepatic apoptosis and inflammation .

    • D1/D5: Linked to hepatocarcinogenesis via EMT marker upregulation .

Vaccine Development

  • Recombinant L-HBsAg is used to study antibody binding. Lenvervimab, a human monoclonal antibody, shows coherent avidity to genotype D’s S antigen .

Antiviral Drug Screening

  • PreS1-targeting compounds (e.g., Myrcludex B) block NTCP interaction, validated using recombinant L-HBsAg .

Pathogenesis Studies

  • Genotype D’s L-HBsAg promotes higher intracellular HBV DNA levels compared to other genotypes .

Key Research Findings

Study FocusKey ResultCitation
PreS1 N-terminus ImpactD-type preS1 increases HBsAg secretion and infectivity vs. C-type
PreS2 Deletion MutantsΔpreS2(18–22) reduces virion secretion by 50% in genotype D
Subgenotype PathogenicityD2 induces caspase-3/Bax upregulation; D1 elevates fibrogenic markers

Challenges and Future Directions

  • Glycosylation Variability: Recombinant L-HBsAg lacks native glycosylation patterns when produced in E. coli, limiting immunological studies .

  • Functional Assays: Standardizing infectivity models (e.g., HepG2-NTCP cells) remains critical for cross-study comparisons .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. If you have a specific format requirement, please specify it in your order remarks, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributor for specific delivery time.
Note: All our proteins are shipped with normal blue ice packs by default. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
S; Large envelope protein; L glycoprotein; L-HBsAg; LHB; Large S protein; Large surface protein; Major surface antigen
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-389
Protein Length
Full Length of Mature Protein
Species
Hepatitis B virus genotype D (isolate Germany/1-91/1991) (HBV-D)
Target Names
S
Target Protein Sequence
GQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHG GLLGWSPQAQGIIQTLPANPPPASTNRQTGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQ DPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDPALNMENITSGLLGPLLVLQAG FFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLR RFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCC CTKPSDGNCTCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMM WYWGPSLYRILSPFLPLLPIFFCLWVYI
Uniprot No.

Target Background

Function
The large envelope protein of the Hepatitis B virus exists in two topological conformations: 'external' or Le-HBsAg, and 'internal' or Li-HBsAg. The external conformation attaches the virus to cell receptors, initiating infection. This interaction dictates species specificity and liver tropism, leading to virion internalization primarily through caveolin-mediated endocytosis. The large envelope protein further facilitates fusion between the virion membrane and endosomal membrane. In its internal conformation, the protein contributes to virion morphogenesis and acts as a matrix protein by mediating contact with the nucleocapsid. The middle envelope protein plays a crucial role in virion budding, inducing budding independently of the nucleocapsid. This process results in the formation of subviral lipoprotein particles, 22 nm in diameter, lacking a nucleocapsid.
Protein Families
Orthohepadnavirus major surface antigen family
Subcellular Location
Virion membrane.

Q&A

What is the structure and functional significance of the HBV genotype D Large envelope protein?

The HBV Large envelope protein (L) consists of three domains: PreS1, PreS2, and S. In HBV genotype D, the L protein plays critical roles in viral entry by binding to the NTCP receptor through its PreS1 domain and in virion assembly by interacting with the nucleocapsid. The protein undergoes glycosylation, resulting in two forms detectable by Western blotting: p39 (unglycosylated) and gp42 (glycosylated). The L protein adopts multiple conformations during the viral life cycle, with a topological switch after secretion that confers infectivity to the virion .

The L protein functions as a molecular platform, recruiting S proteins and core proteins in a perinuclear environment during virion assembly. This tripartite interaction is essential for successful viral particle formation and release .

How does genotype D Large envelope protein differ from other HBV genotypes?

HBV genotype D Large envelope protein exhibits distinct characteristics compared to other genotypes:

GenotypeKey Features of Large Envelope ProteinAssociated Clinical Outcomes
D (vs. A)Different transcription levels of PreS2/S mRNAVaried pathogenicity by subgenotype
D2/D3Higher expression of certain viral proteinsMore associated with hepatic inflammation and fibrosis
D1/D5D1: High HBx expression; D5: Reduced PreS2/S transcriptIncreased risk of hepatocarcinogenesis

Genotype D is predominantly classified as having the subtype ayw, which refers to specific antigenic determinants on the surface protein . These differences contribute to genotype-specific pathogenesis and clinical outcomes in HBV infection.

What are the common expression systems for producing recombinant HBV genotype D Large envelope protein?

Multiple expression systems are utilized for producing recombinant HBV envelope proteins, each with specific advantages:

Expression SystemAdvantagesLimitationsApplications
E. coliHigh yield, cost-effectiveLacks glycosylationStructural studies
YeastSome post-translational modificationsAltered glycosylation patternsImmunological studies
Mammalian cells (e.g., HEK293)Authentic glycosylation and foldingLower yield, higher costFunctional studies
BaculovirusHigh yield with eukaryotic modificationsComplex setupLarge-scale production

For studies requiring authentic glycosylation patterns critical for L protein function, mammalian expression systems are preferred . The choice of expression system should be guided by the specific research objectives and required protein characteristics.

What methodologies are most effective for studying interactions between HBV genotype D Large envelope protein and the viral core?

Multiple complementary approaches provide comprehensive insights into envelope-core interactions:

  • Co-immunoprecipitation (Co-IP): Effectively detects direct protein-protein interactions in cellular contexts. Studies have identified several core amino acids essential for direct interaction with L, including residue Y132 (crucial for capsid formation) and residues L60, L95, K96, and I126 .

  • Confocal microscopy: Provides spatial information about protein colocalization. Research has demonstrated that the L protein serves as a platform for recruiting S and core proteins in perinuclear regions .

  • Site-directed mutagenesis: Systematic mutation of specific amino acids followed by functional assays has identified critical residues mediating envelope-core interactions.

  • Linear monomeric HBV genome transfection: Using unit-length monomeric constructs without heterologous promoters provides a physiologically relevant system for studying envelope-core interactions, as it allows for cccDNA formation .

  • Southern blot analysis: Detects and quantifies viral replicative intermediates resulting from successful envelope-core interactions, providing functional confirmation of these molecular associations .

How do mutations in the preS1 region affect the expression and function of HBV genotype D Large envelope protein?

PreS1 mutations significantly impact L protein expression and function in several ways:

  • ATG (start codon) mutations: Mutations in the preS1 start codon (M1T or M1*) can result in expression of alternative protein forms with increased size (p41/gp44 instead of p39/gp42). This represents a fusion protein between the first 47 residues of the polymerase protein and L protein missing its first 18 residues .

  • Position-dependent effects: In genotype D, the Q3* nonsense mutation generated the p41/p44 doublet, while the K38* mutation eliminated p41/p44 production, indicating position-specific effects within the PreS1 domain .

  • Functional consequences: Since PreS1 contains the NTCP receptor binding site, mutations in this region directly impact viral infectivity. The PreS1 domain has been identified as a target of strong positive selection during HBV evolution, suggesting adaptive value for immune escape or host adaptation .

  • Glycosylation effects: Mutations affecting glycosylation sites can alter protein processing, as evidenced by the finding that p44 is the glycosylated form of p41 .

These findings highlight the complexity of PreS1 region mutations and their multifaceted impact on L protein biology.

What evidence exists for adaptive evolution in the HBV genotype D Large envelope protein during viral divergence?

Multiple lines of evidence demonstrate adaptive evolution in the HBV Large envelope protein:

  • McDonald-Kreitman test results reveal adaptive evolution of non-synonymous variants during genotypic differentiation of HBV .

  • Strong positive selection specifically drives differentiation of the PreS1 domain, which is essential for viral transmission. This selective pressure suggests evolutionary advantages for viral fitness .

  • Directional evolution patterns indicate that HBV genotypes evolve for maintenance or improvement of successful infections, rather than through random genetic drift .

  • Despite constraints from overlapping genes (~50% of HBV genome), adaptive changes still occur in envelope proteins. Researchers have applied specialized classification of variants in overlapping regions to distinguish joint from independent gene evolution .

  • Distinct characteristics of genotype D compared to other genotypes suggest evolutionary adaptations providing advantages in specific host populations or geographical regions .

These findings collectively demonstrate that HBV Large envelope protein undergoes adaptive evolution during viral divergence, contributing to the virus's ability to infect different host populations and potentially influencing disease outcomes.

How do recombination events between HBV genotypes impact the structure and function of the Large envelope protein?

Recombination between HBV genotypes significantly impacts the Large envelope protein in several ways:

  • Breakpoint locations: Recombination between genotypes A and D shows breakpoints at the start of preS2 and at the end of surface coding regions, directly affecting envelope protein structure .

  • Clinical implications: Patients with genotype A/D recombination show more severe liver disease, with two patients having cirrhosis and one having hepatocellular carcinoma, suggesting recombination in envelope proteins may influence disease progression .

  • Functional adaptations: Recombination results in chimeric envelope proteins with properties from both parental genotypes, potentially creating proteins with altered receptor binding, immune escape, or assembly functions .

  • Methodological detection: Researchers identify recombination through phylogenetic analysis of full-length genomes and specific regions (Core and preS2/Surface), using tools such as SimPlot Boot Scanning and amino acid sequence analysis .

  • Antigenicity alterations: Recombination affecting the "a" determinant region can alter antigenicity, potentially affecting diagnostic test accuracy or vaccine efficacy .

These findings underscore the importance of monitoring recombination events when studying HBV envelope proteins and their impact on viral pathogenesis.

What are the differences in virological features among HBV genotype D subgenotypes (D1-D10) related to the Large envelope protein?

HBV genotype D subgenotypes exhibit significant differences in virological features related to the Large envelope protein:

SubgenotypeVirological FeaturesPathogenic PotentialGeographical Distribution
D1High HBx expressionIncreased hepatocarcinogenesis risk; High EMT marker inductionMediterranean, Middle East
D2Highest PreC-mRNA expressionHepatic apoptosis, inflammation, fibrosisEurope, Russia
D3Increased apoptotic markersSimilar to D2; Upregulation of TNF-R1, FasR, TRAIL-R1Global distribution
D5Reduced PreS2/S transcriptER-stress marker overexpressionIndia, Eastern regions
Novel D variant~3% divergence from D1/D2Not fully characterizedWestern Greenland

These differences emphasize the complexity of HBV genotype D and highlight the importance of subgenotyping in understanding disease progression and developing appropriate treatment strategies .

How can researchers differentiate between naturally integrated HBV envelope proteins and those produced during active viral replication?

Several approaches enable differentiation between integrated and replication-derived envelope proteins:

  • Immunoprecipitation with specific antibodies: Antimatrix antibodies that preferentially recognize the pre-S1 domain can distinguish between different forms of envelope proteins .

  • RNA splicing pattern analysis: Integrated HBV may produce distinctive spliced transcripts, such as fusion proteins between polymerase and L protein fragments. Detecting these specific splicing patterns helps identify integration-derived proteins .

  • Replication inhibitor application: Treatment with HBV replication inhibitors (e.g., Lamivudine) suppresses proteins produced during active replication while allowing continued expression from integrated sequences .

  • Functional assays: Envelope proteins from integrated HBV may retain some functions while losing others. For example, integrated HBV-derived envelope proteins can support HDV infection even without HBV replication .

  • Temporal expression analysis: Monitoring envelope protein expression while measuring HBV DNA levels can distinguish between integrated-derived proteins (persisting despite viral suppression) and replication-derived proteins .

These approaches provide researchers with tools to distinguish envelope protein sources, crucial for understanding HBV persistence mechanisms and developing targeted therapies.

What are the challenges in producing functionally authentic recombinant HBV genotype D Large envelope protein?

Producing functionally authentic recombinant HBV genotype D Large envelope protein presents several challenges:

  • Expression system selection: Different systems provide varying post-translational modifications. While bacterial systems offer high yield but lack glycosylation, mammalian systems provide authentic modifications at lower yields .

  • Structural complexity preservation: The L protein contains three domains with complex features including glycosylation sites and disulfide bonds that must be maintained during recombinant production .

  • Conformational requirements: The L protein undergoes a topological switch conferring infectivity. Ensuring recombinant proteins adopt native conformations requires specific cellular contexts .

  • Purification challenges: The hydrophobic transmembrane domains in the S region complicate purification, often requiring detergents that may affect protein structure and function .

  • Subgenotype diversity: With multiple subgenotypes (D1-D10) having distinct properties, producing subgenotype-specific proteins requires careful sequence consideration .

  • Functional validation: Confirming that recombinant proteins retain native functions (receptor binding, particle formation, core interactions) requires complex, non-standardized assays .

Addressing these challenges requires optimizing expression conditions, purification methods, and validation assays specific to research objectives.

How do post-translational modifications affect the functionality of recombinant HBV genotype D Large envelope protein?

Post-translational modifications significantly impact recombinant HBV genotype D Large envelope protein functionality:

  • Glycosylation: The L protein exists in unglycosylated (p39) and glycosylated (gp42) forms. Glycosylation affects protein folding, stability, receptor interactions, and antibody recognition .

  • Molecular weight changes: Due to glycosylation, the protein migrates as approximately 30-35 kDa on SDS-PAGE despite having a calculated molecular mass of ~18 kDa. After deglycosylation, it presents as a 20-25 kDa band smear .

  • Topological changes: After secretion, virions undergo a maturation step involving a topological switch of the L protein that confers infectivity, indicating that conformational changes are essential for function .

  • Expression system impact: The choice of expression system dramatically affects post-translational modifications. Mammalian cell systems (like HEK293) provide the most authentic modifications, while bacterial systems lack them entirely .

  • Disulfide bond formation: The S domain contains multiple cysteine residues forming disulfide bonds crucial for proper folding and maintaining the antigenicity of the "a" determinant region .

Understanding these modifications is essential for producing functionally relevant recombinant proteins for research and potential therapeutic applications.

How do specific amino acid substitutions in the Large envelope protein influence immune recognition and viral persistence?

Specific amino acid substitutions in the Large envelope protein significantly impact immune recognition and viral persistence:

  • "a" determinant mutations: Changes in the major hydrophilic region (MHR) can alter epitope recognition by antibodies. Some substitutions (like lysine to methionine) may not dramatically alter conformation but can still affect antibody binding .

  • Immune escape mechanisms: Certain substitutions allow continued receptor binding while preventing antibody neutralization, enabling viral persistence despite antibody presence from vaccination or natural immunity .

  • Subgenotype-specific immune interactions: Different subgenotypes (D1-D5) show distinct pathogenic potentials, with D2/D3 associated with heightened inflammation, suggesting different immune system interactions related to envelope protein variations .

  • Adaptive evolution evidence: The PreS1 domain shows signs of adaptive evolution, indicating that specific substitutions provide selective advantages for immune evasion .

  • Transcriptional effects: Some substitutions affect transcription levels rather than protein structure directly. For example, PreS2/S-transcript was significantly reduced in subgenotype D5, potentially influencing protein levels and immune recognition .

Understanding these mutation patterns and their functional consequences is crucial for developing effective diagnostics, vaccines, and antiviral therapies targeting HBV genotype D infections.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.