Recombinant Hepatitis B virus genotype D subtype adw Large envelope protein (S)

Shipped with Ice Packs
In Stock

Description

Immunological and Diagnostic Tools

  • Immunoassays: Serves as an antigen in ELISA or Western blotting to detect anti-HBs antibodies .

  • Vaccine Development: Pre-S regions are explored as supplementary antigens to enhance HBsAg-based vaccines, targeting neutralizing epitopes .

Therapeutic Antibody Engineering

Monoclonal antibodies targeting Pre-S1 domains inhibit viral entry. For example:

  • Mechanism: Block receptor binding or membrane fusion .

  • Relevance: Genotype D-specific antibodies may address regional HBV diversity .

Genotype-Specific Studies

HBV genotype D exhibits distinct clinical outcomes (e.g., delayed HBeAg seroconversion, higher cirrhosis risk) . Recombinant LHBs-D adw is used to study:

  • Viral Replication: Intracellular HBV DNA accumulation and core promoter mutations .

  • Subgenotype Diversity: Subtypes D1–D10 vary in geographic distribution and pathogenicity .

Genotype D Subtype adw Epidemiology

  • Global Distribution: Prevalent in Europe, the Mediterranean, and parts of Asia .

  • Subgenotypes: D1–D10 exhibit >4% nucleotide divergence, influencing disease progression and treatment response .

Molecular and Clinical Insights

FeatureGenotype D (vs. A/B)Impact
Precore/BCP MutationsHigher frequencyHBeAg-negative CHB, HCC risk
HBeAg SeroconversionLater onsetProlonged viral replication
HBV DNA LevelsHigher intracellularLiver cell damage

Data from European studies show genotype D dominance in acute infections (80% vs. 10% for genotype A) .

Challenges and Future Directions

  • Protein Stability: Repeated freeze-thaw cycles degrade activity; storage at -80°C is recommended .

  • Vaccine Efficacy: Pre-S1-based vaccines are under investigation to address HBV immune evasion .

  • Therapeutic Targets: Neutralizing antibodies against LHBs-D adw could complement nucleos(t)ide analog therapies .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will do our best to fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All protein shipments are standardly shipped with blue ice packs. If you require dry ice shipping, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us and we will prioritize developing the specified tag.
Synonyms
S; Large envelope protein; L glycoprotein; L-HBsAg; LHB; Large S protein; Large surface protein; Major surface antigen
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-389
Protein Length
Full Length of Mature Protein
Species
Hepatitis B virus genotype D subtype adw (isolate United Kingdom/adyw/1979) (HBV-D)
Target Names
S
Target Protein Sequence
GQNLSTSNPLGFFPDHQLDPAFRANTNNPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHG GLLGWSPQAQGIMQTLPANPPPASTNRQSGRQPTPLSPPLRTTHPQAMHWNSTTFHQTLQ DPRVRGLYFPAGGSSSGTVNPVPTTTSPISSIFSRIGDPALNMENITSGFLGPLLVLQAG FFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPISNHSPTSCPPTCPGYRWMCLR RFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGSCRTCTTPAQGISMYPSCC CTKPSDGNCTCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWMM WYWGPSLYSILSPFLPLLPIFFCLWAYI
Uniprot No.

Target Background

Function
The large envelope protein exists in two topological conformations: 'external' or Le-HBsAg and 'internal' or Li-HBsAg. In its external conformation, the protein binds to cell receptors, initiating infection. This interaction determines species specificity and liver tropism. This attachment triggers virion internalization primarily through caveolin-mediated endocytosis. The large envelope protein also facilitates fusion between the virion membrane and endosomal membrane. In its internal conformation, the protein plays a role in virion morphogenesis and acts as a matrix protein by mediating contact with the nucleocapsid. The middle envelope protein plays a crucial role in virion budding. It induces budding independently of the nucleocapsid. This process leads to the formation of subviral lipoprotein particles, 22 nm in diameter, that lack a nucleocapsid.
Protein Families
Orthohepadnavirus major surface antigen family
Subcellular Location
Virion membrane.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.