Recombinant Hepatitis C virus Genome polyprotein

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify any format requirements in your order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Genome polyprotein; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
384-737
Protein Length
Full Length of Mature Protein
Species
Hepatitis C virus (isolate HC-J7) (HCV)
Target Protein Sequence
STQVTGGQAAHTVRGVASIFSPGSRQDISLINTNGSWHINRTALNCNDSLQTGFFAALFY VRRFNSSGCPERLSSCRKLDDFRIGWGTLEYETNVTNEEDMRPYCWHYPPKPCGIVSAKT VCGPVYCFTPSPVVVGTTDRQGVPTYSWGENETDVFLLNSTRPPRGAWFGCTWMNGTGFT KTCGAPPCRIRRDYNGTLDLLCPTDCFRKHPDTTYLKCGAGPWLTPRCLVDYPYRLWHYP CTVNFTIFKVRMYVGGVEHRLDAACNFTRGDRCRLEDRDRSQQSPLLHSTTEWAVLPCSY SDLPALSTGLLHLHQNIVDVQYLYGLSPAITRHIVKWEWVILLFLLLADARVCA
Uniprot No.

Target Background

Function
The Hepatitis C virus (HCV) genome polyprotein plays multiple crucial roles in the viral lifecycle and host-pathogen interaction. It is packaged into viral nucleocapsids, promoting virion budding and participating in viral particle production through interaction with non-structural protein 5A. Its RNA chaperone function facilitates RNA structural rearrangements during replication, and it modulates viral translation initiation by interacting with the internal ribosome entry site (IRES) and the 40S ribosomal subunit. Furthermore, it influences various cellular signaling pathways, affecting host immunity and lipid metabolism. The polyprotein inhibits the antiviral state by blocking interferon-alpha/beta (IFN-α/β) and IFN-γ signaling pathways, promoting the ubiquitin-mediated proteasomal degradation of phosphorylated STAT1. Conversely, it activates STAT3, contributing to cellular transformation. It regulates cellular gene activity, including c-myc and c-fos, represses the p53 promoter, and sequesters CREB3 and SP110 isoform 3/Sp110b in the cytoplasm. By repressing CDKN1A, it disrupts cell cycle regulation. It targets transcription factors involved in inflammatory and immune responses, suppressing TNF-induced NF-κB activation while activating AP-1. It binds to dendritic cells (DCs) via C1QR1, down-regulating T-lymphocyte proliferation. The polyprotein also alters lipid metabolism, interacting with hepatocellular proteins involved in lipid accumulation and storage, inducing FAS promoter activity, and contributing to hepatic steatosis. The HCV envelope glycoproteins E1 and E2, encoded within the polyprotein, form a heterodimer mediating viral attachment to host cells, entry via clathrin-dependent endocytosis, and membrane fusion. This fusion likely involves conformational changes in the E1/E2 heterodimer. The E1/E2 heterodimer binds host apolipoproteins (APOB and ApoE), forming lipo-viro-particles (LVPs). APOE on the LVP facilitates initial attachment to receptors like heparan sulfate proteoglycans (HSPGs), syndecans (SDC1 and SDC2), the low-density lipoprotein receptor (LDLR), and scavenger receptor class B type I (SCARB1). SCARB1's cholesterol transfer activity exposes E2, enabling its binding to SCARB1 and tetraspanin CD81. E1/E2 heterodimer binding to CD81 activates the EGFR signaling pathway. The E1-E2-EGFR-SCARB1-CD81 complex then interacts with claudin-1 (CLDN1) and occludin (OCLN), ultimately triggering HCV entry. The polyprotein also inhibits host EIF2AK2/PKR activation, preventing the establishment of an antiviral state. Finally, it acts as a viral ligand for CD209/DC-SIGN and CLEC4M/DC-SIGNR on dendritic cells and liver sinusoidal endothelial cells, facilitating viral capture and transmission to hepatocytes and lymphocytes.
Protein Families
Hepacivirus polyprotein family
Subcellular Location
[Core protein precursor]: Host endoplasmic reticulum membrane; Single-pass membrane protein. Host mitochondrion membrane; Single-pass type I membrane protein.; [Envelope glycoprotein E1]: Virion membrane; Single-pass type I membrane protein. Host endoplasmic reticulum membrane; Single-pass type I membrane protein.; [Envelope glycoprotein E2]: Virion membrane; Single-pass type I membrane protein. Host endoplasmic reticulum membrane; Single-pass type I membrane protein. Host lipid droplet.

Q&A

What is the structure and organization of the HCV genome polyprotein?

The HCV genome is approximately 9,600 nucleotides in length, consisting of a single open reading frame (ORF) flanked by 5' and 3' untranslated regions (UTRs). This ORF encodes a polyprotein of about 3,011 amino acid residues that is co-translationally and post-translationally processed into at least nine individual proteins. The polyprotein is organized with structural proteins (core, E1, and E2) at the N-terminal portion, followed by the viroporin p7, and then the nonstructural proteins (NS2, NS3, NS4A, NS4B, NS5A, and NS5B) that form the viral replication complex . The structural proteins constitute the virion components, while the nonstructural proteins are primarily involved in viral genome replication and viral particle assembly .

How are HCV polyproteins processed in infected cells?

HCV polyprotein processing involves multiple proteolytic events mediated by both host and viral proteases:

  • Signal peptidase of the endoplasmic reticulum cleaves at the junctions between C/E1, E1/E2, E2/p7, and p7/NS2

  • Signal peptide peptidase performs additional C-terminal processing of the core protein

  • The NS2 protease mediates self-cleavage at the NS2/NS3 junction

  • The NS3-4A protease complex is responsible for cleaving the remaining junctions (NS3/NS4A, NS4A/NS4B, NS4B/NS5A, and NS5A/NS5B)

This orchestrated proteolytic cascade results in the production of mature viral proteins essential for HCV replication and assembly . The processing occurs in association with the endoplasmic reticulum membrane, where the viral replication complexes eventually form.

What are the functions of different HCV polyprotein-derived proteins?

ProteinSize (kDa)Primary Functions
Core21Viral nucleocapsid formation; modulation of host cell processes
E131Envelope glycoprotein; mediates viral entry; heavily modified by N-linked glycosylation
E270Envelope glycoprotein; receptor binding; viral entry; heavily glycosylated
p7~7Viroporin; ion channel activity; involved in virion assembly
NS223Component of NS2-3 protease; mediates NS2/NS3 cleavage
NS370N-terminal protease domain and C-terminal helicase domain; essential for viral replication
NS4A8Cofactor for NS3 protease; stabilizes NS3 and targets it to membranes
NS4B27Induces membrane web formation; helps establish the viral replication complex
NS5A58Multifunctional phosphoprotein; roles in replication and virion assembly
NS5B68RNA-dependent RNA polymerase; responsible for HCV RNA synthesis

The nonstructural proteins NS3 through NS5B form the core of the viral replication complex, essential for HCV genomic RNA replication .

What is the recombination rate of HCV and how has it been measured?

The recombination rate varies depending on:

  • The genetic similarity between recombining viral strains

  • The genomic distance between marker sites (with higher frequencies as distance increases)

  • The replication competence of resulting recombinants

These findings indicate that while the intrinsic ability of HCV to recombine is high, the viability constraints on recombinant viruses and detection limitations may explain the low frequency of recombinants observed in clinical settings .

What experimental systems exist to study HCV recombination?

Several experimental systems have been developed to study HCV recombination:

  • GFP-based reporter systems: These involve engineered HCV genomes containing portions of GFP genes that can only generate functional GFP upon recombination, allowing for fluorescence-based detection and quantification of recombination events .

  • Next-generation sequencing (NGS) approaches: Deep sequencing technologies enable comprehensive analysis of intra-host viral genetic variation and can detect rare recombination events that might be missed by conventional methods .

  • Cell culture systems: HCV cell culture (HCVcc) systems using hepatoma cell lines (such as Huh7.5) permit the study of replication-competent viruses and recombination events in controlled conditions .

  • Mismatch amplification mutation assays: These PCR-based techniques have been adapted to detect naturally occurring recombinant HCV mutants .

These methodologies collectively provide a toolbox for researchers to investigate the mechanisms and constraints of HCV recombination under various conditions.

How does HCV recombination contribute to viral evolution and drug resistance?

HCV recombination plays several critical roles in viral evolution:

  • Genetic diversity generation: Recombination allows the rapid exchange of large portions of genetic material, potentially creating novel viral variants with altered phenotypes .

  • Drug resistance development: Recombination can facilitate the accumulation of multiple resistance mutations in a single genome. Studies have shown that drug-resistant NS3 mutants can arise rapidly (within 2 weeks) upon exposure to protease inhibitors like telaprevir .

  • Immune escape: Recombination events in regions encoding envelope proteins can generate variants that evade neutralizing antibodies.

  • Adaptation to selective pressures: Patients with certain IL-28B genotypes show different patterns of viral evolution, suggesting host genetics shapes viral adaptation through selective pressure .

Importantly, the high frequency of recombination between similar genomes suggests that even within a single infected patient, recombination could facilitate the reassortment of mutations, accelerating adaptation to immune and drug pressures .

What expression systems are most effective for studying HCV polyprotein?

Several expression systems have proven valuable for studying HCV polyprotein processing and function:

  • Vaccinia virus transient-expression assays: These have been successfully used to map HCV-encoded polypeptides and study HCV polyprotein processing across multiple mammalian cell lines, including human hepatoma cells (HepG2) .

  • Subgenomic replicon systems: These self-replicating RNA constructs contain the nonstructural protein coding region of HCV and permit studies of polyprotein processing and replication complex formation.

  • HCV cell culture (HCVcc) systems: Full-length, replication-competent HCV genomes can be studied in permissive cell lines like Huh7.5, allowing for investigation of the complete viral life cycle including polyprotein expression and processing.

  • In vitro translation systems: Cell-free systems supplemented with microsomal membranes can recapitulate aspects of HCV polyprotein processing and have been useful for mechanistic studies.

The choice of expression system depends on the specific research question, with vaccinia virus-based systems and HCV replicons being particularly valuable for polyprotein processing studies .

How can researchers study protein-protein interactions within the HCV replication complex?

Understanding protein-protein interactions within the HCV replication complex is crucial for developing antiviral strategies. Several approaches include:

  • Coevolution analysis: This computational approach identifies residues that have co-evolved across viral strains, indicating functional or structural relationships. This method has successfully reconstructed the protein-protein interaction network of HCV at residue resolution, providing highly relevant predictions of interaction sites for experimental validation .

  • Super-resolution microscopy: This technique has enabled visualization and analysis of NS3-NS5B proteins within replication organelles (ROs), revealing their spatial organization and relationships .

  • Protein complementation assays: Split reporter systems (e.g., split GFP, split luciferase) can detect protein interactions when fragments reconstitute functional reporters upon proximity.

  • Co-immunoprecipitation and mass spectrometry: These techniques identify protein complexes and their components, including both viral-viral and viral-host protein interactions.

Coevolution analysis is particularly powerful as it can predict specific residues involved in protein-protein interactions, providing precise targets for mutagenesis studies and potential drug development .

What techniques are used to detect recombination events in HCV clinical samples?

Detecting recombination events in clinical samples requires sophisticated methodologies:

  • Next-Generation Sequencing (NGS): Deep sequencing provides comprehensive coverage of viral populations and can identify rare recombinant variants. This technology has been used to study transmission events among injection drug users by analyzing the HCV hypervariable region .

  • PCR-based techniques: Targeted amplification with genotype-specific primers can identify potential recombination junctions, followed by sequencing for confirmation.

  • Phylogenetic analyses: Comparing phylogenetic trees constructed from different genomic regions can identify incongruences suggestive of recombination.

  • Recombination detection programs: Software tools like RDP, SimPlot, and Bootscan analyze sequence alignments to identify potential recombination breakpoints and parental sequences.

These approaches have varying sensitivity levels, with NGS offering the highest resolution but requiring sophisticated bioinformatic analysis. The integration of multiple methods provides the most reliable detection of recombination events .

How do host factors influence HCV polyprotein processing and genome replication?

Host factors play critical roles in HCV polyprotein processing and genome replication:

  • IL-28B genotype: Single nucleotide polymorphisms near the IL-28B gene influence viral evolution patterns. Patients with the rs12979860-CC polymorphism show different patterns of amino acid substitutions in NS5A compared to non-CC patients, suggesting host genetics shapes selective pressure on the virus .

  • PKR-binding region interactions: The protein kinase R (PKR)-binding region of NS5A appears to be a hotspot for recombination and is implicated in interferon response modulation. Recombination events in this region may contribute to the emergence of interferon-resistant strains .

  • Host proteases: Signal peptidase and signal peptide peptidase are essential for processing the structural region of the HCV polyprotein .

  • Membrane-associated factors: Host factors associated with the endoplasmic reticulum are involved in the formation of the membranous web structures where HCV replication occurs .

Understanding these host-virus interactions provides potential targets for therapeutic intervention that may be less susceptible to viral resistance than direct-acting antivirals targeting viral proteins.

How do replication organelles (ROs) regulate HCV genome replication?

Replication organelles (ROs) are specialized membrane structures that serve as the physical platform for HCV genome replication:

  • Structure and formation: ROs are derived from modified endoplasmic reticulum (ER) membranes and contain the viral replication complexes (proteins NS3 to NS5B). They form distinct membranous web structures that compartmentalize the replication process .

  • Function in viral replication: ROs create protective microenvironments that:

    • Concentrate viral and host factors required for replication

    • Shield viral RNA from host innate immune sensors

    • Provide a scaffold for organizing the replication machinery

    • Separate replication from other stages of the viral life cycle

  • Regulation mechanisms: The biogenesis of ROs is primarily driven by NS4B and NS5A proteins, with NS5A serving as a regulatory switch between genome replication and virion assembly .

  • Impact on antiviral strategies: Direct-acting antivirals (DAAs) targeting components of the replication complex disrupt the function of ROs, inhibiting viral replication. Understanding RO formation and maintenance provides opportunities for developing novel antivirals .

The compartmentalization of replication within ROs represents a sophisticated viral strategy to optimize replication efficiency while evading host defenses.

What are the implications of HCV genetic diversity and recombination for vaccine development?

HCV genetic diversity and recombination present significant challenges for vaccine development:

  • Quasispecies diversity: The low fidelity of NS5B RNA polymerase generates a swarm of closely related viral variants (quasispecies) within infected individuals, providing a diverse target for immune responses .

  • Genotype variation: At least six major HCV genotypes exist with 30-35% sequence divergence, complicating the development of broadly protective vaccines .

  • Recombination potential: Although previously thought to be rare, higher-than-expected recombination rates may facilitate immune escape through the generation of novel variants .

  • Envelope protein variability: E1 and E2, the primary targets for neutralizing antibodies, show particularly high variability, with hypervariable regions undergoing constant evolution under immune pressure .

  • Impact on vaccine strategies: Successful vaccines will likely need to:

    • Target conserved epitopes across genotypes

    • Induce broad neutralizing antibody responses

    • Generate robust T-cell responses against conserved regions

    • Account for potential recombination events that could overcome vaccine-induced immunity

The recognition that HCV recombines at high frequency between similar genomes indicates that even a successful vaccine may need periodic updates to address evolving viral populations .

Why are recombinant HCV strains detected relatively rarely in patients despite high in vitro recombination rates?

The discrepancy between high in vitro recombination rates and relatively rare detection of recombinants in clinical samples can be explained by several factors:

  • Viability constraints: Many recombination events may produce non-viable viruses, particularly when recombination occurs between distantly related genotypes or in functionally critical regions .

  • Detection limitations: Traditional sequencing methods have limited sensitivity for detecting low-frequency recombinants in mixed viral populations .

  • Fitness disadvantage: Recombinant viruses may have reduced fitness compared to parental strains, leading to their rapid clearance in competitive environments .

  • Co-infection requirements: Recombination requires co-infection of the same cell with different viral strains, which may be relatively uncommon in vivo compared to laboratory conditions .

  • Trade-offs in recombination potential: There is a balance between sequence identity requirements for homologous recombination and the ability to detect recombination between similar sequences .

Recent advances in next-generation sequencing suggest that recombination may be more common than previously recognized, particularly between closely related variants within the same subtype, where detection is most challenging .

What are the methodological challenges in studying HCV polyprotein processing?

Researchers face several methodological challenges when studying HCV polyprotein processing:

  • Temporal dynamics: The co-translational and post-translational processing events occur rapidly and sequentially, making it difficult to capture intermediate states.

  • Membrane association: HCV polyprotein processing occurs in association with the ER membrane, complicating biochemical studies and requiring specialized systems that maintain membrane integrity .

  • Complex proteolytic cascade: Multiple proteases (both viral and cellular) are involved in polyprotein processing, necessitating sophisticated approaches to distinguish their specific contributions .

  • Protein stability issues: Some HCV proteins, particularly NS2, are inherently unstable, making their detection and characterization challenging.

  • System limitations: No single experimental system recapitulates all aspects of authentic HCV infection and polyprotein processing, requiring researchers to integrate findings from multiple approaches .

Advances in real-time imaging, mass spectrometry, and cell-free reconstitution systems are helping to address these challenges, providing more comprehensive insights into the dynamics of HCV polyprotein processing.

How will understanding HCV recombination impact future direct-acting antiviral (DAA) strategies?

Insights into HCV recombination mechanics have important implications for antiviral strategies:

  • Resistance development: High recombination rates can accelerate the accumulation of resistance mutations, as demonstrated by the rapid emergence of protease inhibitor resistance. This underscores the importance of combination therapy to raise the genetic barrier to resistance .

  • Diagnostic considerations: The potential for recombinant strains affects diagnostic test design, which must account for genetic diversity including recombinants.

  • Treatment tailoring: Understanding patient-specific viral evolution patterns (influenced by host factors like IL-28B genotype) could enable more personalized treatment approaches .

  • Drug target selection: Targeting highly conserved regions with limited recombination potential may reduce the likelihood of resistance development.

  • Novel therapeutic approaches: Disrupting viral recombination machinery could represent a new antiviral strategy that complements existing DAAs.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.