Recombinant Herpetosiphon aurantiacus Cobalamin synthase (cobS)

Shipped with Ice Packs
In Stock

Description

Introduction to Cobalamin Synthase (cobS)

Cobalamin synthase, encoded by the cobS gene, functions as a crucial enzyme in the late steps of adenosylcobalamin (vitamin B12) biosynthesis. In bacterial systems, this enzyme catalyzes a critical reaction in the nucleotide loop assembly pathway, which is fundamental to producing functional cobalamin molecules. Research with Salmonella typhimurium has demonstrated that CobS possesses cobalamin synthase activity, facilitating the assembly of the nucleotide loop of cobalamin from its precursors . The enzyme specifically catalyzes the attachment of the nucleotide component (α-ribazole-5′-phosphate) to adenosylcobinamide-GDP, forming adenosylcobalamin-5′-phosphate, which is a penultimate intermediate in cobalamin biosynthesis .

The biochemical function of cobalamin synthase has been well-characterized through in vitro studies. Researchers have shown that CobS catalyzes the reaction that yields adenosylcobalamin-5′-phosphate, which was isolated by high-performance liquid chromatography (HPLC), identified through UV-visible spectroscopy and mass spectrometry, and demonstrated to support the growth of cobalamin auxotrophs . These findings conclusively established the role of CobS as the cobalamin(-5′-phosphate) synthase enzyme.

Herpetosiphon aurantiacus Cobalamin Synthase Structure and Properties

Herpetosiphon aurantiacus is a filamentous, gliding bacterium belonging to the phylum Chloroflexi. The cobalamin synthase from H. aurantiacus shares functional similarity with its counterparts in other bacterial species but possesses distinct structural characteristics specific to this organism.

Functional Characteristics

Based on the functional characterization of cobS proteins in other bacterial species, particularly Salmonella typhimurium, the H. aurantiacus cobS likely catalyzes the attachment of α-ribazole-5′-phosphate to adenosylcobinamide-GDP . This reaction represents a crucial step in the assembly of the nucleotide loop of cobalamin, which defines the final structure and functionality of the vitamin B12 molecule.

The enzymatic activity of cobalamin synthase is particularly significant because it joins two complex molecular components to form the complete cobalamin structure. In bacterial systems such as Salmonella, this activity has been demonstrated through in vitro reactions where AdoCbi-GDP (the product of the CobU reaction) and α-ribazole-5′-P (the product of the CobT reaction) were successfully joined by CobS to yield a functional cobamide .

Research Applications and Significance

Recombinant Herpetosiphon aurantiacus cobalamin synthase has several significant applications in biochemical and molecular research, particularly in studies focused on vitamin B12 biosynthesis and metabolism.

Enzymatic Studies

The purified recombinant cobS protein serves as a valuable tool for enzymatic assays investigating the catalytic mechanisms of cobalamin biosynthesis. By studying the kinetics and substrate specificity of the enzyme, researchers can gain insights into the biochemical processes involved in vitamin B12 production . These investigations are crucial for understanding how bacteria synthesize this essential cofactor and may provide insights into potential targets for antimicrobial development.

Studies with Salmonella typhimurium CobS have already demonstrated that cobalamin synthase can be assayed in vitro, with specific activities measured at approximately 8-22 nmol of product per minute per mg of protein . Similar enzymatic characterization of the H. aurantiacus enzyme would provide valuable comparative data.

Biological and Medical Significance

Cobalamin (vitamin B12) functions as an essential cofactor for various enzymes involved in critical metabolic processes. The biosynthesis of this complex molecule involves numerous enzymatic steps, with cobS catalyzing a key reaction in the final stages of the pathway.

The importance of cobalamin in bacterial metabolism is further highlighted by the presence of cobalamin riboswitches, which are regulatory RNA elements that modulate gene expression in response to vitamin B12 levels . These riboswitches have been identified in various bacterial species, including Leptospira licerasiae, where they regulate the expression of genes involved in cobalamin transport and biosynthesis .

In infectious Leptospira species, the presence of cobalamin riboswitches and complete cob operons suggests that these organisms can synthesize vitamin B12 de novo, while saprophytic species like L. biflexa lack these features . This distinction underscores the potential importance of cobalamin biosynthesis in bacterial pathogenicity and environmental adaptation.

Future Research Opportunities

Further investigations into Herpetosiphon aurantiacus cobalamin synthase could focus on several promising areas:

  1. Detailed kinetic characterization to elucidate its catalytic mechanism and compare it with cobalamin synthases from other bacterial species.

  2. Crystal structure determination to provide insights into the protein's three-dimensional architecture and substrate binding sites.

  3. Investigation of potential inhibitors that could specifically target cobS as a means to disrupt bacterial vitamin B12 biosynthesis, potentially leading to novel antimicrobial strategies.

  4. Exploration of the enzyme's role in the broader context of H. aurantiacus metabolism and ecological niche.

  5. Comparative genomic and functional studies to understand the evolution of cobalamin biosynthesis pathways across different bacterial lineages.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If a specific tag type is required, please inform us, and we will prioritize its implementation.
Synonyms
cobS; Haur_4390; Adenosylcobinamide-GDP ribazoletransferase; Cobalamin synthase; Cobalamin-5'-phosphate synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-249
Protein Length
full length protein
Species
Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785)
Target Names
cobS
Target Protein Sequence
MIKHLAEALRFLTILPIPGKPALSEQALVRSMVAFPLAGTLIGGLVAATWFGATWLWGTT TGSLCAILTWGAITSGLHLDGIADSADALFSWRSRERKLEIMKDSRIGTMGAIALISILL LKWLFVLGCGDLAWRALIVAPTLGRWVDIIGIFWFPPAAEGGLGRTFHDHTRRSDFWWAT SCAGLVAAGLLWWWAGLIFAVVIVATIIIARWMVRSLGGLTGDTYGALCEIAEMLVLAVV AALVNHQVL
Uniprot No.

Target Background

Function

This enzyme catalyzes the formation of adenosylcobalamin (Ado-cobalamin) by joining adenosylcobinamide-GDP and α-ribazole. It also synthesizes adenosylcobalamin 5'-phosphate from adenosylcobinamide-GDP and α-ribazole 5'-phosphate.

Database Links
Protein Families
CobS family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Herpetosiphon aurantiacus and why is it significant for research?

Herpetosiphon aurantiacus is a ubiquitous, chemoheterotrophic, filamentous gliding bacterium with the ability to prey on other microbes through a "wolf pack" mechanism. It belongs to the Herpetosiphon genus which currently comprises five known species (H. aurantiacus, H. geysericola, H. giganteus, H. gulosus, and the recently discovered H. llansteffanense). The genus is significant for research due to its predatory capabilities and production of antimicrobial secondary metabolites such as siphonazole . The predatory nature of H. aurantiacus makes it a valuable model for studying bacterial predation mechanisms and for discovering potential new antimicrobial compounds for clinical applications.

How does recombinant expression of H. aurantiacus cobS differ from native expression?

The recombinant expression of H. aurantiacus cobS involves the production of the enzyme in a heterologous host system, which allows for controlled expression and potential modification of the protein. When expressed recombinantly, cobS is typically tagged for purification purposes, which may affect its structure and function compared to the native form. According to product information, recombinant cobS is often stored in Tris-based buffer with 50% glycerol to maintain stability .

In contrast, native expression occurs within H. aurantiacus cells, where the enzyme's production is regulated by the bacterium's natural genetic control mechanisms and influenced by environmental factors. This native expression is integrated with other metabolic pathways and cellular processes, potentially affecting the enzyme's activity and interactions with other cellular components.

What are the optimal conditions for expressing and purifying recombinant H. aurantiacus cobS?

Optimal expression and purification of recombinant H. aurantiacus cobS requires careful consideration of expression systems, growth conditions, and purification methods. Based on available research data, the following protocol represents an effective approach:

Expression System Selection:

  • E. coli BL21(DE3) is commonly used for recombinant cobS expression due to its reduced protease activity and compatibility with T7 promoter-based expression systems

  • Care must be taken with expression levels as excessive cobS expression can compromise membrane integrity in E. coli

Induction and Growth Conditions:

  • Culture temperature: 25-30°C (lower temperatures may reduce inclusion body formation)

  • Inducer concentration: 0.1-0.5 mM IPTG (higher concentrations may lead to toxic effects)

  • Post-induction growth time: 4-6 hours (longer periods may result in degradation)

Purification Strategy:

  • Affinity chromatography using His-tag or similar tags determined during the production process

  • Buffer composition: Tris-based buffer (pH 7.5-8.0) with stabilizing agents

  • Storage in 50% glycerol at -20°C for extended stability

When designing experiments involving cobS, it's essential to consider co-expression with proteins like CobC or PspA, which have been shown to counteract the negative effects of cobS overproduction in certain bacterial systems .

How can researchers assess the functional activity of recombinant cobS in vitro?

Assessment of recombinant cobS functional activity requires specialized assays that measure either substrate consumption or product formation. The following methodological approaches are recommended:

Enzymatic Activity Assays:

  • Spectrophotometric Assays:

    • Monitor the conversion of cobalt-precorrin intermediates by measuring absorbance changes at specific wavelengths

    • Track NAD(P)H consumption as a measure of reductive steps in the reaction

  • HPLC-Based Assays:

    • Quantify substrate depletion and product formation using reverse-phase HPLC

    • Employ fluorescence detection for increased sensitivity when analyzing corrinoid compounds

  • Mass Spectrometry:

    • Use LC-MS/MS to identify and quantify reaction intermediates and products

    • Employ isotope labeling to track specific atoms through the enzymatic reaction

Reaction Conditions Optimization Table:

ParameterOptimal RangeNotes
pH7.5-8.0Higher pH values may destabilize cobalt coordination
Temperature28-37°CTemperature sensitivity varies by specific assay
Metal ions0.1-1.0 mM Co²⁺Essential cofactor for activity
Buffer50 mM Tris-HCl or HEPESPhosphate buffers may inhibit activity
Reducing agents1-5 mM DTT or β-mercaptoethanolMaintains thiol groups in reduced state

When interpreting assay results, researchers should be aware that membrane-associated properties of cobS may affect its behavior in solution-based assays . Incorporating appropriate membrane mimetics or detergents may enhance activity measurements.

What experimental approaches can be used to study the interaction between cobS and membrane integrity?

Research has revealed that elevated levels of cobamide synthase can affect membrane integrity and proton motive force in bacterial cells . To study these interactions, researchers can employ several experimental approaches:

Membrane Permeability Assays:

  • Use fluorescent dyes like TO-PRO-3 to monitor changes in membrane permeability associated with cobS expression, similar to methods described in the literature

  • Employ ethidium bromide accumulation assays to assess membrane transport disruption, as demonstrated in previous cobS studies

Membrane Potential Measurements:

  • Utilize carbocyanine dyes such as 3,3′-diethyloxacarbocyanine iodide (DiOC₂) to monitor changes in membrane potential during cobS expression

  • Implement patch-clamp techniques for direct measurement of membrane electrical properties in proteoliposomes containing reconstituted cobS

Co-expression Studies:

  • Design experiments with balanced co-expression of cobS with CobC or PspA, which have been shown to ameliorate the detrimental effects of cobS overexpression on membrane integrity

  • Use dual-promoter expression systems to achieve controlled expression ratios between cobS and potential interacting partners

Microscopy Approaches:

  • Apply advanced imaging techniques like cryo-electron microscopy to visualize membrane structural changes

  • Implement fluorescence microscopy with membrane-specific probes to track real-time changes upon cobS induction

These methodologies provide complementary approaches to understanding the complex relationship between cobS activity and membrane biology, which appears to be an important aspect of cobS function beyond its enzymatic role in cobalamin synthesis.

How does cobS from H. aurantiacus compare with cobalamin synthases from other bacterial species?

Comparative analysis of cobS from H. aurantiacus and other bacterial species reveals important evolutionary relationships and functional conservation. The following comparisons highlight key similarities and differences:

Sequence Homology Analysis:
H. aurantiacus cobS shares varying degrees of sequence identity with cobalamin synthases from other bacterial species. While the catalytic core regions tend to be well-conserved, there are notable differences in membrane-interacting domains and regulatory regions. These differences may reflect adaptations to specific cellular environments and metabolic requirements.

Functional Conservation vs. Specialization:
Although the fundamental enzymatic function of cobS is conserved across species, research suggests species-specific adaptations. For instance, the effects of cobS overexpression on membrane integrity observed in E. coli may differ in native H. aurantiacus cells due to co-evolution with other cellular components .

Evolutionary Context:
H. aurantiacus, as a predatory bacterium, may have evolved specialized features in its cobS protein that relate to its unique ecological niche. The predatory lifestyle of Herpetosiphon involves the production of various antimicrobial compounds, and the cobalamin pathway intersects with several other metabolic pathways that could be involved in these specialized functions .

What role might cobS play in the predatory behavior of H. aurantiacus?

The potential role of cobS in H. aurantiacus predation represents an intriguing area for research that connects cobalamin metabolism with predatory behavior:

H. aurantiacus employs a "wolf pack" predation mechanism, where groups of cells collectively secrete antimicrobial substances to kill prey organisms . While direct evidence linking cobS to predation is limited, several hypotheses can be formulated based on available data:

  • Metabolic Support for Predation: Cobalamin is an essential cofactor for numerous metabolic processes. By ensuring adequate cobalamin supply through cobS activity, H. aurantiacus may maintain the metabolic capacity needed to produce antimicrobial compounds used in predation.

  • Membrane-Related Functions: Research has shown that cobS can influence membrane integrity . This property might be leveraged during predation, potentially contributing to the secretion of antimicrobial compounds or affecting the cell's ability to interact with prey organisms.

  • Involvement in Secondary Metabolite Production: H. aurantiacus produces various antimicrobial secondary metabolites like siphonazole . The cobalamin pathway intersects with several other metabolic pathways involved in secondary metabolite production, suggesting possible regulatory connections.

  • Adaptation to Nutrient Acquisition: Predatory behavior allows H. aurantiacus to acquire nutrients from prey bacteria. Cobalamin synthesis through cobS activity may be regulated in response to nutrient availability, potentially influencing predatory behavior under different environmental conditions.

These hypotheses present intriguing directions for future research into the multifaceted roles of cobS in H. aurantiacus biology beyond its canonical function in cobalamin synthesis.

How can research on H. aurantiacus cobS contribute to the development of novel antimicrobials?

Research on H. aurantiacus cobS offers several promising avenues for antimicrobial development:

Target-Based Drug Discovery:
Cobalamin biosynthesis represents an essential pathway in many bacteria but is absent in humans, making it an attractive target for antimicrobial development. Understanding the structure and function of H. aurantiacus cobS could enable the design of specific inhibitors that disrupt bacterial cobalamin synthesis without affecting human metabolism.

Exploitation of Membrane Effects:
The observation that cobS overexpression can compromise membrane integrity in bacteria suggests potential applications in developing membrane-disrupting antimicrobial strategies. Compounds that mimic or enhance this effect could potentially be developed into novel membrane-targeting antimicrobials.

Predatory Mechanism Insights:
H. aurantiacus exhibits predatory activity against clinically relevant pathogens including Escherichia coli, Klebsiella pneumoniae, Staphylococcus aureus, and Candida albicans . Understanding how cobS contributes to this predatory capability could inform the development of new antimicrobial approaches that mimic natural predatory mechanisms.

Combination Therapy Approaches:
Research shows that balanced expression of cobS with proteins like CobC or PspA can ameliorate membrane disruption effects . This suggests potential for combination therapies that target multiple components of the cobalamin synthesis pathway or related cellular processes for enhanced antimicrobial efficacy.

What experimental systems can be used to study H. aurantiacus predation and the potential role of cobS?

Investigating H. aurantiacus predation and cobS involvement requires specialized experimental systems:

Predation Assay Methodologies:

  • Lawn Culture Method: This approach can be employed to analyze predatory activity against various prey organisms of clinical relevance, similar to methods used in previous studies of H. llansteffanense . The technique involves spreading prey bacteria as a lawn and applying the predator to observe zones of clearing.

  • Co-culture Systems: Quantitative co-culture experiments with H. aurantiacus and prey bacteria allow for monitoring predation kinetics and efficiency. These systems can be modified to assess the impact of cobS manipulation on predatory activity.

  • Genetic Manipulation Approaches:

    • Overexpression or knockdown of cobS in H. aurantiacus to assess effects on predatory efficiency

    • Introduction of mutations in key cobS domains to identify regions important for predation

    • Construction of reporter strains to monitor cobS expression during predation

  • Membrane Vesicle Studies: H. llansteffanense outer membrane vesicles have demonstrated killing activity against prey organisms . Similar studies with H. aurantiacus could examine whether cobS is present in these vesicles and contributes to their antimicrobial activity.

Analytical Techniques for Predation Assessment:

  • Flow cytometry to quantify prey cell death, similar to methods used for H. llansteffanense vesicle studies

  • Microscopy approaches to visualize predator-prey interactions

  • Metabolomic analysis to identify compounds produced during predation

These experimental systems provide a comprehensive toolkit for investigating the complex relationship between cobS function and predatory behavior in H. aurantiacus.

How do genomic variations in cobS across Herpetosiphon species correlate with predatory capabilities?

Comparative genomic analysis of cobS across Herpetosiphon species reveals potential connections between genetic variation and predatory function:

The Herpetosiphon genus currently comprises five known species, each with potentially different predatory capabilities and antimicrobial production profiles . Genomic analysis of these species reveals variations that may influence predatory behavior:

Comparative Genomic Analysis Results:

These genomic variations may influence:

  • Enzymatic Efficiency: Variations in cobS sequence could affect catalytic efficiency and thereby impact the bacterium's metabolic capacity for producing antimicrobial compounds

  • Membrane Interactions: Differences in cobS membrane-interacting domains might affect predatory capabilities through alterations in membrane properties or secretion systems

  • Regulatory Networks: Variations in regulatory regions of cobS could influence its expression in response to environmental cues, potentially correlating with predatory behavior

The recently characterized H. llansteffanense shows robust predatory activity against multiple clinically relevant pathogens and possesses diverse secondary metabolite biosynthetic clusters , suggesting that genomic variations across species may indeed correlate with predatory capabilities. Further comparative studies focusing specifically on cobS variations could provide valuable insights into this relationship.

What are common challenges in working with recombinant H. aurantiacus cobS and how can they be addressed?

Researchers working with recombinant H. aurantiacus cobS frequently encounter several challenges that require specialized troubleshooting approaches:

Challenge 1: Toxicity During Expression

  • Problem: Elevated levels of cobS can kill bacterial host cells by disrupting membrane integrity and dissipating proton motive force

  • Solutions:

    • Implement tightly controlled inducible expression systems

    • Co-express cobS with CobC or PspA, which have been shown to ameliorate toxic effects

    • Reduce growth temperature to minimize expression levels

    • Use bacterial strains with enhanced membrane stability

Challenge 2: Protein Solubility and Stability

  • Problem: As a membrane-associated protein, cobS may exhibit solubility issues during purification

  • Solutions:

    • Optimize buffer conditions with appropriate detergents

    • Store in 50% glycerol to enhance stability

    • Consider fusion tags that enhance solubility

    • Implement on-column refolding protocols if necessary

Challenge 3: Assessing Enzymatic Activity

  • Problem: Complex reaction requirements and potential membrane dependence complicate activity assays

  • Solutions:

    • Incorporate membrane mimetics or liposomes in activity assays

    • Ensure availability of all necessary cofactors

    • Consider coupled enzyme assays to enhance sensitivity

    • Use multiple complementary assay methods to confirm activity

Challenge 4: Distinguishing Native Functions from Artifacts

  • Problem: Effects observed in heterologous expression systems may not reflect native functions

  • Solutions:

    • Compare results across multiple expression systems

    • Validate findings through complementary approaches

    • Design controls that distinguish specific enzymatic effects from general membrane disturbances

How can researchers reconcile contradictory data regarding cobS function?

When faced with contradictory data about cobS function, researchers should implement a systematic approach to data reconciliation:

Potential Sources of Contradictory Data:

  • Expression System Variations: Different host organisms may interact differently with cobS, particularly given its effects on membrane integrity

  • Experimental Conditions: Variations in buffer conditions, temperature, or presence of cofactors can significantly impact results

  • Protein Modifications: Different tagging strategies or purification methods may affect protein function

  • Assay Methodology Differences: Various activity assays may measure different aspects of cobS function

Reconciliation Strategies:

  • Comparative Analysis Framework:

    • Systematically compare experimental conditions across studies

    • Identify key variables that differ between contradictory results

    • Design targeted experiments to test the impact of these variables

  • Integrative Experimental Approach:

    • Combine multiple methodologies within a single study

    • Perform parallel experiments in different expression systems

    • Utilize both in vitro and in vivo approaches to validate findings

  • Molecular Dissection Strategy:

    • Generate domain-specific mutations to isolate functions

    • Separate enzymatic activity from membrane effects through targeted modifications

    • Construct chimeric proteins combining domains from different species to isolate species-specific functions

By implementing these strategies, researchers can develop a more nuanced understanding of cobS function that incorporates seemingly contradictory data into a coherent model that recognizes the protein's multifaceted roles.

What considerations are important when scaling up recombinant cobS production for research purposes?

Scaling up recombinant cobS production for research applications requires careful consideration of several key factors:

Process Optimization Considerations:

  • Expression System Selection:

    • Bacterial systems: Balance protein yield against toxicity concerns

    • Alternative hosts: Consider yeast or insect cell systems for potentially reduced toxicity

    • Cell-free systems: May circumvent membrane toxicity issues entirely

  • Fermentation Parameters:

    • Implement fed-batch strategies to control growth rate and expression

    • Monitor dissolved oxygen levels to ensure adequate aeration

    • Control pH carefully to maintain optimal conditions for protein stability

    • Consider temperature shifts to balance growth and protein expression

  • Co-expression Strategies:

    • Scale up co-expression with CobC or PspA to mitigate toxicity effects

    • Optimize induction timing and inducer concentrations for balanced expression

    • Consider dual-plasmid or single-vector strategies for consistent co-expression ratios

Purification Scale-up Considerations:

  • Chromatography Optimization:

    • Evaluate resin capacity and flow rate constraints

    • Consider membrane adsorbers for potentially improved purification of membrane-associated cobS

    • Optimize elution conditions for maximum yield and purity

  • Quality Control Metrics:

    • Implement consistent activity assays for batch-to-batch comparison

    • Develop stability indicators to monitor protein quality throughout the process

    • Establish acceptance criteria based on research application requirements

The table below summarizes key parameters that should be monitored during scale-up:

ParameterSmall-scale RangeScale-up ConsiderationsQuality Impact
Cell density (OD₆₀₀)0.6-0.8 at inductionMay require lower density to manage toxicityHigher density increases yield but may affect protein quality
Induction time4-6 hoursMay need modification based on bioreactor conditionsImpacts balance between yield and toxicity
Temperature25-30°CHeat transfer limitations in larger vesselsAffects protein folding and inclusion body formation
Aeration30-40% DOScaling up requires adjusted sparging strategyCritical for cell viability and protein expression
pH7.0-7.5Requires robust control strategy in large scaleInfluences protein stability and host cell metabolism

By carefully addressing these considerations, researchers can successfully scale up cobS production while maintaining protein quality and managing the unique challenges associated with this membrane-interactive enzyme.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.