Recombinant Herpetosiphon aurantiacus Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
mscL; Haur_3312; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-127
Protein Length
full length protein
Species
Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785)
Target Names
mscL
Target Protein Sequence
MFKEFKEFAFKGNVLDLAIGVIIGAAFGKIVTALVDVVIMPIISIILSLILNDVNIATWQ FSIGATPIMIGVLIKTIIEFLIIAFVLFLFVKGINSTRRKQEVEAPAAPPPSEEVLLLRE IRDSLQK
Uniprot No.

Target Background

Function

A membrane channel activated by stretch forces in the lipid bilayer. It likely plays a role in regulating cellular osmotic pressure changes.

Database Links
Protein Families
MscL family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Herpetosiphon aurantiacus and why is its mscL protein significant for research?

Herpetosiphon aurantiacus is a predatory bacterium belonging to the Chloroflexi phylum. It exhibits "wolf pack" predation, killing prey by secreting antimicrobial substances into its surroundings . The organism is aerobic, mesophilic, and was originally isolated from lake water .

The mscL protein from H. aurantiacus is significant for research because:

  • It represents a mechanosensitive channel from a unique predatory bacterium with distinct evolutionary adaptations

  • Mechanosensitive channels play crucial roles in osmotic regulation and cellular responses to mechanical stress

  • Comparing mscL from diverse bacteria helps understand evolutionary conservation and specialization of these critical membrane proteins

  • H. aurantiacus produces antimicrobial compounds, making its membrane proteins potential targets for understanding its predatory lifestyle

What are the structural characteristics of H. aurantiacus mscL protein?

The recombinant full-length H. aurantiacus mscL protein consists of:

  • 137 amino acid residues (full length 1-137aa)

  • An N-terminal His-tag for purification purposes when expressed recombinantly

  • Typical mechanosensitive channel domains that respond to membrane tension

  • Conserved structural features that are consistent with other bacterial mechanosensitive channels

While the specific 3D structure of H. aurantiacus mscL has not been fully determined, other bacterial mscL proteins typically form homopentameric structures with two transmembrane domains per subunit that create a channel pore through the membrane.

How is the recombinant H. aurantiacus mscL typically expressed and purified?

Based on standard protocols for similar recombinant proteins, the expression and purification typically involve:

  • Expression system: E. coli is the preferred host for recombinant expression

  • Vector design: Incorporation of an N-terminal His-tag for affinity purification

  • Expression conditions: Induction under controlled temperature and medium composition

  • Purification method: Immobilized metal affinity chromatography (IMAC) using the His-tag

  • Final form: The purified protein is typically provided as a lyophilized powder

  • Storage buffer: Tris/PBS-based buffer containing 6% trehalose at pH 8.0

For reconstitution, researchers should:

  • Briefly centrifuge the vial before opening

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Add 5-50% glycerol (final concentration) for long-term storage

  • Store at -20°C to -80°C and avoid repeated freeze-thaw cycles

How do the amino acid sequences of mscL proteins from H. aurantiacus compare with mscL from other bacterial species?

Comparative analysis reveals important similarities and differences between mscL proteins:

SpeciesLength (aa)Sequence Similarity to H. aurantiacusNotable Features
H. aurantiacus137100%Predatory bacterium
E. coli137ModerateSequence: MSIIKEFREFAMRGNVVDLAVGVIIGAAFGKIVSSLVADIIMPPLGLLIGGIDFKQFAVTLREAQGDIPAVVMHYGVFIQNVFDFLIVAFAIFMAIKLINKLNRKKEEPAAATPAPTKEE
Roseobacter denitrificans142ModerateSequence: MLNEFKTFISKGNVMDMAVGIIIGAAFTAIVSSLVADLVNPFIALFTGGIDFSGWFYALDGETYASLAAATDAGAPVFAFGNFIMAVINFLIIAFVVFMLVKTVNRIKDAAEGEKEAVAEEPAGPTELDILKEIRDALAKQG
Roseiflexus sp.NAHigher (as within same phylum)Similar ecological niche

Sequence conservation is typically highest in the transmembrane domains and pore-lining regions, while variation is more common in cytoplasmic domains, reflecting evolutionary adaptations to different environmental conditions.

What experimental approaches are recommended for functional characterization of recombinant H. aurantiacus mscL?

For comprehensive functional characterization, researchers should consider:

  • Electrophysiological methods:

    • Patch-clamp of reconstituted channels in liposomes

    • Planar lipid bilayer recordings to measure single-channel conductance

  • Structural analysis:

    • Circular dichroism (CD) spectroscopy to assess secondary structure integrity

    • Thermal stability analysis via CD thermal melts (20-90°C) monitoring at 222 nm

  • Membrane reconstitution:

    • Liposome reconstitution with varied lipid compositions

    • Assessment of channel gating in response to membrane tension

  • Mutagenesis studies:

    • Site-directed mutagenesis of conserved residues

    • Creation of chimeric channels with domains from other bacterial mscL proteins

  • Osmotic shock assays:

    • In vivo complementation studies in mscL-deficient E. coli strains

    • Survival rate measurement following hypoosmotic shock

What role might the mscL protein play in H. aurantiacus predatory behavior?

While the direct role of mscL in predation is not fully established, several potential functions can be proposed based on the biology of H. aurantiacus:

  • Osmotic regulation during prey interaction:

    • H. aurantiacus employs a "wolf pack" predation strategy by secreting antimicrobial substances

    • During predation, osmotic changes may occur that require mechanosensitive channel activity

  • Sensing physical contact with prey:

    • Mechanosensitive channels could serve as mechanoreceptors during predator-prey interactions

    • Physical contact with prey might trigger cellular responses mediated by mscL

  • Coordination with secondary metabolite production:

    • H. aurantiacus produces antimicrobial compounds like siphonazole and auriculamide

    • mscL activity might be linked to regulatory pathways controlling production of these compounds

  • Protection during exposure to prey defensive compounds:

    • Prey organisms may release compounds that affect membrane integrity

    • mscL could serve as an emergency release valve to prevent cell lysis

The genome of H. aurantiacus contains multiple biosynthetic gene clusters for secondary metabolites, including two polyketide synthase (PKS), four nonribosomal peptide synthase (NRPS), five hybrid PKS/NRPS, and three bacteriocin clusters , suggesting complex predatory mechanisms that may involve mechanosensing components.

What methodological approaches are recommended for assessing the mechanosensitive properties of recombinant H. aurantiacus mscL in artificial membrane systems?

Advanced biophysical characterization requires specialized methodologies:

  • Spheroplast patch-clamp recordings:

    • Expression of recombinant H. aurantiacus mscL in E. coli

    • Preparation of spheroplasts by lysozyme treatment and osmotic stabilization

    • Gigaohm seal formation and application of negative pressure to the patch pipette

    • Recording channel activity at different membrane tensions

    • Analysis of pressure threshold for activation, conductance, and gating kinetics

  • Reconstitution in liposomes for controlled tension studies:

    • Purification of recombinant protein using IMAC

    • Reconstitution in liposomes of defined lipid composition

    • Application of pressure using micropipettes or microfluidic devices

    • Fluorescence-based flux assays using calcein or other fluorescent markers

    • Assessment of channel activation thresholds in different lipid environments

  • High-speed atomic force microscopy (HS-AFM):

    • Visualization of conformational changes in real-time

    • Correlation of structural changes with applied membrane tension

    • Mapping of the energy landscape of channel gating

  • Molecular dynamics simulations:

    • Construction of H. aurantiacus mscL model based on homologous structures

    • Simulation of membrane tension effects on channel conformation

    • Identification of critical residues for mechanosensation

    • Comparison with experimental data to validate computational predictions

How can researchers address challenges in the heterologous expression and purification of fully functional H. aurantiacus mscL?

Several advanced approaches can overcome common challenges:

  • Optimization of expression systems:

    • Testing multiple E. coli strains (C41/C43(DE3), BL21(DE3)pLysS, Rosetta)

    • Evaluation of different induction temperatures (16-37°C)

    • Use of specialized media formulations for membrane protein expression

    • Co-expression with chaperones to improve folding

  • Solubilization and purification strategies:

    • Screening of detergents (DDM, LDAO, CHAPS) for optimal extraction

    • Evaluation of novel solubilizing agents like SMA copolymers or nanodiscs

    • Two-step purification combining IMAC with size exclusion chromatography

    • Quality control using multi-angle light scattering to assess oligomeric state

  • Troubleshooting expression issues:

    • Implementation of fusion partners (MBP, SUMO) to enhance solubility

    • Codon optimization for expression in different host systems

    • Use of tightly controlled expression systems to prevent toxicity

    • Screening for stabilizing mutations based on computational predictions

  • Activity verification:

    • Development of high-throughput functional assays

    • In vivo complementation of mscL-deficient strains

    • Biophysical characterization to confirm proper folding

What are the current limitations and future directions in understanding the structure-function relationship of H. aurantiacus mscL in the context of bacterial mechanosensation?

Current limitations and future research directions include:

  • Structural challenges:

    • Limited high-resolution structural data for H. aurantiacus mscL

    • Difficulty in crystallizing membrane proteins for X-ray crystallography

    • Need for cryo-EM studies to resolve the structure in different conformational states

  • Functional gaps:

    • Incomplete understanding of the physiological role in the native organism

    • Limited knowledge about interaction with other membrane components

    • Unclear relationship between mechanosensation and predatory behavior

  • Future directions:

    • Application of in situ structural biology approaches to study mscL in its native membrane environment

    • Investigation of potential differences in mechanosensitivity between predatory and non-predatory bacteria

    • Exploration of the evolutionary relationships between mechanosensitive channels across different bacterial phyla

    • Development of biosensors based on the mechanosensitive properties of H. aurantiacus mscL

  • Integration with systems biology:

    • Examination of the role of mscL in the broader context of H. aurantiacus metabolism

    • Investigation of potential regulatory interactions with biosynthetic gene clusters for antimicrobial compounds

    • Analysis of gene expression patterns under conditions that trigger predatory behavior

  • Comparative studies:

    • Systematic comparison of mscL properties across multiple Herpetosiphon species (H. aurantiacus, H. geysericola, H. giganteus, H. gulosus, and H. llansteffanense)

    • Correlation of mscL function with predatory efficiency against different prey organisms

Understanding these aspects will provide valuable insights into bacterial mechanosensation and may reveal novel aspects of predator-prey interactions in microbial communities.

What controls should be included when studying recombinant H. aurantiacus mscL protein function?

A robust experimental design should include the following controls:

  • Negative controls:

    • Empty vector-transformed cells for expression studies

    • Liposomes without reconstituted protein for functional assays

    • Heat-inactivated protein samples to confirm activity loss

    • mscL-knockout strains without complementation

  • Positive controls:

    • Well-characterized mscL proteins from model organisms (E. coli mscL)

    • Known mechanosensitive channel activators

    • Positive osmotic shock response in complemented strains

  • Specificity controls:

    • Site-directed mutants with altered mechanosensitivity

    • Chimeric channels with domains from other bacterial mscL proteins

    • Selective channel blockers to confirm specific activity

  • Technical controls:

    • Multiple membrane tension measurement methods

    • Various lipid compositions to assess environment dependence

    • Range of protein concentrations in reconstitution experiments

How can researchers reconcile conflicting data when characterizing H. aurantiacus mscL properties?

When faced with conflicting experimental results, researchers should:

  • Systematically evaluate methodological differences:

    • Compare protein purification protocols for potential differences in protein quality

    • Assess reconstitution conditions that might affect channel function

    • Review measurement techniques for systematic biases

  • Consider biological variables:

    • Verify the genetic sequence of the expressed construct

    • Evaluate post-translational modifications in different expression systems

    • Assess the impact of lipid environment on channel properties

  • Implement orthogonal approaches:

    • Apply multiple independent techniques to measure the same parameter

    • Use both in vitro and in vivo assays to cross-validate findings

    • Compare results with computational predictions

  • Statistical analysis:

    • Perform adequate biological and technical replicates

    • Apply appropriate statistical tests for significance

    • Consider power analysis to determine sample size requirements

  • Collaborative verification:

    • Engage with other laboratories to independently verify key findings

    • Share protocols in detail to identify subtle methodological differences

What are the most reliable methods for quantifying the expression levels and functional activity of recombinant H. aurantiacus mscL?

For precise quantification of expression and activity:

  • Expression level quantification:

    • Western blotting with anti-His antibodies for tagged protein

    • Quantitative mass spectrometry with isotope-labeled standards

    • Fluorescence-based quantification using GFP fusion proteins

    • Total protein determination combined with densitometric analysis of SDS-PAGE

  • Functional activity assessment:

    • Patch-clamp electrophysiology for direct channel conductance measurement

    • Fluorescence-based flux assays in reconstituted liposomes

    • Osmotic shock survival assays in complemented bacterial strains

    • Stopped-flow spectroscopy to measure rapid kinetics of channel opening

  • Structure-based evaluation:

    • Circular dichroism to assess secondary structure integrity

    • Thermal stability assays to determine protein folding quality

    • Limited proteolysis to evaluate proper folding

    • Size-exclusion chromatography to confirm proper oligomeric state

  • Correlation analysis:

    • Developing standard curves relating protein quantity to functional activity

    • Multiple parameter assessment to ensure comprehensive characterization

    • Comparison with well-characterized mechanosensitive channels as benchmarks

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.