Recombinant Herpetosiphon aurantiacus NADH-quinone oxidoreductase subunit A (nuoA)

What is Herpetosiphon aurantiacus nuoA and what is its biological function?

NADH-quinone oxidoreductase subunit A (nuoA) is a small membrane-spanning subunit of the respiratory complex I in Herpetosiphon aurantiacus, a predatory bacterium belonging to the family Herpetosiphonaceae in the phylum Chloroflexota . The protein functions as part of the NADH dehydrogenase complex (Complex I), which is responsible for transferring electrons from NADH to quinones in the respiratory chain, contributing to the generation of a proton motive force used for ATP synthesis. The full-length protein consists of 118 amino acids and is encoded by the nuoA gene (Haur_4980) . The protein is also known by alternative names such as NADH dehydrogenase I subunit A, NDH-1 subunit A, and NUO1 .

The amino acid sequence of the protein is:
MLTNYAFIGIFALAAITFPLLPLVLSAFLRPNRPTPVKLSTYECGLEAIGDIWVQFKVQYYLYALAFVIFDIETVFLYPWAVAYGQLGLFALFEMVVFLAILTIGLVYAWKKGALEWI

What are the standard expression systems used for recombinant nuoA production?

The standard expression system for recombinant Herpetosiphon aurantiacus nuoA is Escherichia coli. When producing the recombinant protein, researchers typically use an E. coli expression system with a histidine tag (His-tag) fusion at the N-terminus to facilitate purification . The full-length protein (amino acids 1-118) can be successfully expressed in this system, resulting in a functional recombinant protein that retains its native properties.

The expression and purification process typically involves:

• Cloning the nuoA gene into an appropriate expression vector

• Transformation into a suitable E. coli strain

• Induction of protein expression (often using IPTG)

• Cell lysis and extraction

• Affinity chromatography using the His-tag

• Quality control verification via SDS-PAGE (purity >90%)

What are the optimal storage conditions for recombinant nuoA to maintain stability?

To maintain stability of recombinant Herpetosiphon aurantiacus nuoA, researchers should follow these evidence-based storage protocols:

• Long-term storage: The protein should be stored at -20°C or -80°C, with the latter preferred for extended storage periods .

• Buffer composition: A Tris-based buffer with 50% glycerol is optimal for storage, as it helps maintain protein stability and prevents degradation . For lyophilized preparations, Tris/PBS-based buffer with 6% trehalose at pH 8.0 is recommended .

• Aliquoting: It is crucial to aliquot the protein immediately after purification to avoid repeated freeze-thaw cycles, which significantly reduce protein activity and stability .

• Working aliquots: For ongoing experiments, working aliquots can be maintained at 4°C for up to one week .

• Reconstitution protocol: For lyophilized preparations, it is recommended to briefly centrifuge the vial before opening and reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL with 5-50% glycerol added as a cryoprotectant .

How does the membrane topology of nuoA contribute to the function of the NADH:quinone oxidoreductase complex?

The membrane topology of Herpetosiphon aurantiacus nuoA is crucial for its functional integration into the NADH:quinone oxidoreductase complex. Analysis of the protein sequence reveals that nuoA is a small membrane-spanning protein with hydrophobic regions that anchor it within the membrane . Recent research suggests a revised transmembrane orientation for the NADH:quinone oxidoreductase complex components, though the specific details for H. aurantiacus nuoA are still being elucidated .

The amino acid sequence (MLTNYAFIGIFALAAITFPLLPLVLSAFLRPNRPTPVKLSTYECGLEAIGDIWVQFKVQYYLYALAFVIFDIETVFLYPWAVAYGQLGLFALFEMVVFLAILTIGLVYAWKKGALEWI) contains multiple hydrophobic segments consistent with transmembrane helices . These regions are critical for:

• Anchoring the protein within the membrane

• Facilitating interactions with other subunits of the complex

• Potentially creating channels for proton translocation

• Maintaining the structural integrity of the respiratory complex

Researchers investigating the membrane topology should consider combining computational prediction methods with experimental approaches such as cysteine scanning mutagenesis, proteolytic mapping, and electron microscopy to fully characterize the membrane integration pattern of nuoA.

What are the challenges in obtaining high-resolution structural data for membrane-bound nuoA?

Obtaining high-resolution structural data for membrane-bound proteins like Herpetosiphon aurantiacus nuoA presents several significant challenges for researchers:

• Detergent selection and optimization: The choice of detergent for solubilization is critical and requires extensive screening to find conditions that maintain the native conformation while efficiently extracting the protein from the membrane.

• Protein stability issues: The hydrophobic nature of nuoA (evident from its amino acid sequence with multiple hydrophobic regions ) makes it inherently unstable outside its native membrane environment, often leading to aggregation during purification.

• Crystallization barriers: Membrane proteins typically have limited hydrophilic surface area for forming crystal contacts, making crystallization particularly difficult. The small size of nuoA (118 amino acids ) further complicates this process.

• Sample heterogeneity: Variations in lipid content, detergent micelle size, and post-translational modifications can lead to sample heterogeneity, reducing the likelihood of obtaining well-ordered crystals.

• Complex formation requirements: As nuoA functions as part of a larger complex, structural studies might require co-expression or reconstitution with partner subunits to maintain physiologically relevant conformations.

Methodological approaches to overcome these challenges include:

• Using lipidic cubic phase crystallization

• Employing nanodiscs or amphipols as membrane mimetics

• Applying single-particle cryo-electron microscopy

• Considering fusion protein strategies to increase the hydrophilic surface area

• Stabilizing the protein through systematic mutagenesis of flexible regions

What is known about potential post-translational modifications of nuoA and their functional significance?

Current research on post-translational modifications (PTMs) of Herpetosiphon aurantiacus nuoA is limited, representing a significant knowledge gap in the field. Based on analysis of the protein sequence and comparison with related systems, researchers should consider investigating the following potential PTMs:

• Phosphorylation: The nuoA sequence contains potential serine, threonine, and tyrosine residues that could be targets for kinase-mediated phosphorylation, potentially regulating complex assembly or activity.

• Acetylation: N-terminal acetylation might occur, affecting protein stability or interactions within the respiratory complex.

• Lipid modifications: Given its membrane localization, covalent attachment of lipid moieties could be important for proper membrane insertion and complex formation.

Experimental approaches to characterize PTMs in nuoA should include:

• Mass spectrometry-based proteomic analysis (particularly LC-MS/MS)

• Site-directed mutagenesis of potential modification sites

• In vitro enzymatic assays to confirm modifying enzymes

• Comparative analysis across growth conditions to identify regulatory PTMs

The functional significance of these modifications might include regulation of:

• Protein-protein interactions within the complex

• Membrane targeting and insertion

• Complex I assembly dynamics

• Electron transport efficiency

• Adaptation to changing metabolic conditions

What are the optimal conditions for enzymatic activity assays of recombinant nuoA?

When designing enzymatic activity assays for recombinant Herpetosiphon aurantiacus nuoA, researchers should consider that it functions as part of the larger NADH:quinone oxidoreductase complex (Complex I). Therefore, assays typically measure electron transfer activities either in reconstituted systems or with isolated complex components. Optimal conditions include:

Buffer System and pH:

• Phosphate buffer (50-100 mM) at pH 7.2-7.5

• Alternative: HEPES buffer (20-50 mM) at pH 7.4

• Addition of 100-150 mM NaCl for ionic strength

Substrate Concentrations:

• NADH: 50-200 μM (typically start with 100 μM)

• Quinone acceptor (e.g., ubiquinone-1): 50-100 μM

Reaction Components:

• Magnesium chloride: 5 mM

• Membrane fractions or reconstituted proteoliposomes: 50-100 μg protein/mL

• Recombinant nuoA: 1-10 μg/mL (concentration should be optimized)

Assay Conditions:

• Temperature: 30-37°C (optimize based on protein stability)

• Assay duration: Typically 5-15 minutes

• Spectrophotometric monitoring at 340 nm (NADH oxidation) or using artificial electron acceptors

Controls to Include:

• Specific inhibitors (e.g., rotenone at 5-10 μM)

• Heat-inactivated enzyme

• Reaction without substrate

The assay should be optimized for linearity, reproducibility, and sensitivity based on the specific experimental goals. Additionally, researchers should consider whether to assay nuoA alone or as part of the reconstructed complex, which would better reflect its native function.

How can researchers verify the proper folding and membrane integration of recombinant nuoA?

Verifying proper folding and membrane integration of recombinant Herpetosiphon aurantiacus nuoA requires a multi-faceted approach combining biochemical, biophysical, and functional assays:

Biochemical Verification Methods:

• Protease protection assays: Exposing membrane-integrated nuoA to proteases will result in selective digestion of exposed regions while membrane-embedded segments remain protected.

• Detergent extraction profiles: Properly folded membrane proteins exhibit characteristic extraction profiles with different detergents (e.g., DDM, LDAO, or digitonin).

• Size exclusion chromatography: Well-folded nuoA should elute with a consistent profile indicating a homogeneous, non-aggregated state.

Biophysical Characterization:

• Circular dichroism (CD) spectroscopy: Can verify secondary structure content, particularly the alpha-helical content expected from the sequence analysis .

• Fluorescence spectroscopy: Intrinsic tryptophan fluorescence can indicate tertiary structure integrity.

• Thermal stability assays: Differential scanning fluorimetry or differential scanning calorimetry can assess protein stability.

Functional Integration Tests:

• Reconstitution into liposomes: Successfully reconstituted protein should show orientation-specific topology.

• NADH:quinone oxidoreductase activity: Activity measurements in reconstituted systems can confirm functional integration.

• Binding assays with known interaction partners: Co-purification or pull-down assays with other complex I subunits.

Structural Visualization:

• Negative stain electron microscopy: Can verify proper complex formation when nuoA is assembled with partner proteins.

• Cryo-electron microscopy: For higher resolution structural confirmation of proper folding.

A properly folded and integrated nuoA protein should demonstrate resistance to aggregation, expected secondary structure content, thermal stability consistent with membrane proteins, and the ability to associate with other complex components in a functional manner.

What strategies can be employed to improve the yield and purity of recombinant nuoA?

Optimizing the yield and purity of recombinant Herpetosiphon aurantiacus nuoA requires addressing the challenges associated with membrane protein expression. The following comprehensive strategy can significantly enhance results:

Expression System Optimization:

• Strain selection: BL21(DE3), C41(DE3), or C43(DE3) E. coli strains are commonly used for membrane proteins, with the latter two specifically engineered for toxic membrane proteins .

• Vector selection: pET vectors with tunable promoters can help control expression levels.

• Fusion partners: Consider testing MBP, SUMO, or Mistic fusions to enhance solubility and membrane targeting.

Expression Conditions:

• Temperature: Lower temperatures (16-25°C) often improve folding of membrane proteins.

• Induction strategy: Use low IPTG concentrations (0.1-0.5 mM) and extended expression times (16-24 hours).

• Media composition: Addition of glycerol (0.5-1%) and specific metal ions may enhance proper folding.

Purification Strategy Enhancement:

• Detergent screening: Systematically test different detergents (DDM, LDAO, Fos-choline) for optimal extraction efficiency.

• Two-step affinity purification: Utilize the histidine tag for initial capture , followed by a second affinity or ion exchange step.

• Size exclusion chromatography: As a final polishing step to remove aggregates and achieve >95% purity.

Stability Enhancement During Purification:

• Buffer optimization: Include glycerol (10-20%) and specific lipids to maintain native-like environment.

• Additives: Consider adding specific cardiolipins or phospholipids to stabilize the protein.

• pH and salt optimization: Systematic screening to identify optimal conditions.

Quality Control Criteria:

• SDS-PAGE: Should show >90% purity

• Western blotting: To confirm identity and integrity

• Mass spectrometry: For precise molecular weight confirmation and detection of potential degradation

• Activity assays: To verify functional integrity

Implementing these strategies systematically while monitoring protein quality at each step will lead to significant improvements in both yield and purity of the recombinant nuoA protein.

How does the sequence of H. aurantiacus nuoA compare with homologous proteins from other bacterial species?

Comparative sequence analysis of Herpetosiphon aurantiacus nuoA with homologous proteins from other bacterial species reveals important patterns of conservation and divergence that provide insights into function and evolution:

Conservation Analysis:
The 118-amino acid sequence of H. aurantiacus nuoA shows several highly conserved regions when aligned with homologs, particularly in the transmembrane domains. Key conservation patterns include:

• Transmembrane helices: The hydrophobic regions forming transmembrane segments show the highest degree of sequence conservation, reflecting their critical structural role.

• Quinone-binding motifs: Residues involved in quinone interaction sites show significant conservation across diverse bacterial species.

• Subunit interface regions: Amino acids at interfaces with other Complex I components display higher conservation than exposed regions.

Table 1: Sequence Identity Comparison of nuoA Across Selected Bacterial Species

Phylogenetic Implications:
The phylogenetic position of H. aurantiacus as a member of Chloroflexota is reflected in its nuoA sequence, which shows distinctive features compared to those from more studied bacterial phyla. This aligns with findings about the unique metabolic capabilities of this organism, including its ability to produce specialized metabolites like 4-hydroxyphenylglycine .

Functional Divergence:
Sequence variations across species correlate with adaptations to different environmental niches and metabolic strategies. H. aurantiacus, being a predatory bacterium , may have evolved specific features in its respiratory complex components to support its energetic requirements for predation.

Researchers investigating nuoA should utilize these comparative sequence analyses to identify functionally critical residues for mutagenesis studies and to understand evolutionary relationships that might inform about specialized functions in H. aurantiacus.

What experimental approaches can be used to study protein-protein interactions between nuoA and other subunits of the NADH:quinone oxidoreductase complex?

Studying protein-protein interactions between Herpetosiphon aurantiacus nuoA and other subunits of the NADH:quinone oxidoreductase complex requires specialized techniques suitable for membrane protein complexes. Researchers should consider the following methodological approaches:

In vitro Interaction Studies:

• Co-immunoprecipitation (Co-IP): Using antibodies against nuoA or epitope tags to pull down interacting partners. This approach requires:

  • Generation of specific antibodies against nuoA or use of the His-tag

  • Mild solubilization conditions to preserve complexes

  • Mass spectrometry analysis of co-precipitated proteins

• Cross-linking coupled with mass spectrometry (XL-MS): Chemical cross-linkers can capture transient interactions.

  • Use membrane-permeable cross-linkers (e.g., DSS, BS3)

  • Optimize cross-linker concentration and reaction time

  • Employ LC-MS/MS analysis with specialized software for cross-link identification

• Surface plasmon resonance (SPR): For quantitative binding kinetics between nuoA and purified partner subunits.

  • Immobilize His-tagged nuoA on Ni-NTA sensor chips

  • Flow potential interacting partners over the surface

  • Determine association/dissociation constants

In vivo Interaction Studies:

• Bacterial two-hybrid systems: Adapted for membrane proteins to detect interactions in a cellular context.

  • Use split-ubiquitin or BACTH (Bacterial Adenylate Cyclase Two-Hybrid) systems

  • Create fusion constructs with nuoA and potential partners

  • Screen for positive interactions via reporter gene activation

• FRET (Förster Resonance Energy Transfer): For detecting proximity between nuoA and other subunits in intact membranes.

  • Generate fluorescent protein fusions

  • Measure energy transfer between fluorophores as indication of proximity

  • Analyze by confocal microscopy or spectrofluorometry

Structural Methods:

• Cryo-electron microscopy: For visualization of the entire complex architecture.

  • Purify intact Complex I containing nuoA

  • Image using single-particle cryo-EM

  • Perform 3D reconstruction to identify subunit positions and interfaces

• Hydrogen-deuterium exchange mass spectrometry (HDX-MS): To map interaction surfaces.

  • Compare deuterium uptake patterns of nuoA alone versus in complex

  • Identify protected regions as potential interaction interfaces

Computational Approaches:

• Molecular docking and simulation: To predict and model subunit arrangements.

  • Generate structural models of nuoA based on sequence

  • Perform docking with structures of partner subunits

  • Validate predictions with experimental data

These complementary approaches provide a comprehensive toolkit for researchers studying the integration of nuoA within the NADH:quinone oxidoreductase complex, with each method offering unique insights into different aspects of these interactions.

How might mutations in the H. aurantiacus nuoA gene affect the assembly and function of the respiratory complex?

Impact on Complex Assembly:

• Transmembrane domain mutations: Alterations in the hydrophobic regions of nuoA would likely disrupt membrane integration, potentially preventing proper complex assembly. Specific effects include:

  • Misfolding and degradation of the nuoA subunit

  • Failure to recruit other complex components

  • Formation of incomplete subcomplexes

• Interface residue mutations: Amino acids at subunit interfaces are critical for:

  • Proper docking of adjacent subunits

  • Stabilization of the quaternary structure

  • Sequential assembly of the entire complex

• Conserved motif alterations: Highly conserved sequence motifs often indicate functionally critical regions where mutations would:

  • Disrupt critical structural elements

  • Prevent proper folding pathways

  • Destabilize the assembled complex

Functional Consequences:

• Electron transfer efficiency: Mutations can affect:

  • NADH oxidation rates

  • Electron tunneling between redox centers

  • Coupling between electron transfer and proton pumping

• Proton translocation: Alterations in channel-forming regions may:

  • Reduce proton pumping efficiency

  • Create proton leaks across the membrane

  • Uncouple electron transfer from proton motive force generation

• ROS production: Certain mutations might:

  • Increase production of reactive oxygen species

  • Damage the complex and surrounding membrane

  • Trigger oxidative stress responses

Table 2: Predicted Effects of Different Types of nuoA Mutations

Experimental Approaches to Study Mutations:

• Site-directed mutagenesis: Create specific mutations in the nuoA sequence to test hypotheses about critical residues.

• Complementation assays: Express mutant versions in nuoA-deficient strains to assess functional rescue.

• Blue native PAGE: Analyze complex assembly states with different nuoA variants.

• Activity assays: Measure NADH oxidation rates and electron transfer in membrane preparations with mutant complexes.

Understanding the consequences of nuoA mutations provides insights into the structure-function relationships within the respiratory complex and may inform strategies for engineering variants with altered properties.