Recombinant Herpetosiphon aurantiacus NADH-quinone oxidoreductase subunit K (nuoK)

What is the basic structure of Herpetosiphon aurantiacus NADH-quinone oxidoreductase subunit K?

The nuoK subunit (counterpart of the mitochondrial ND4L subunit) is the smallest subunit of NDH-1. It consists of three transmembrane segments (TM1-3) arranged in a linear fashion and connected by short loops . According to structural models, nuoK spans the membrane with these three α-helices. The amino acid sequence of H. aurantiacus nuoK is: MISTNAYVILSAILFTLIGVVGVLVRRNVIVMFMSVELMLNSANLIALIAFARARAESDGQIITFFVIAVAAAEVAVGLALLVSIFRAKKTTNIDDVNTLKG . This protein structure is characterized by hydrophobic regions that facilitate membrane integration, with specific conserved residues that are crucial for its function.

What are the key conserved residues in nuoK and their functional significance?

Two conserved glutamic acid residues in nuoK play critical roles in its function:

• Glu-36 (located in TM2): This residue is perfectly conserved across all species. Mutation of Glu-36 to Ala/Gln leads to a complete loss of NDH-1 activities, indicating its essential role in function .

• Glu-72 (located in TM3): This residue is almost perfectly conserved across species. Mutations at this position (E72A and E72Q) cause partial but significant loss of activities .

Additionally, two charged arginine residues (Arg-25 and Arg-26) in the short cytoplasmic loop (loop-1) connecting TM1 and TM2 are important for energy-transducing electron transfer and the architecture of NDH-1 .

How does nuoK interact with other subunits in the NDH-1 complex?

The nuoK subunit exhibits extensive interaction with the NuoN subunit. Its C-terminus extends between NuoN and helix HL (an α-helix of NuoL that spans multiple subunits in the membrane domain anchoring near NuoN), forming numerous inter-subunit links . Studies suggest that nuoK functions in conjunction with subunits NuoA and NuoJ in the coupling mechanism of NDH-1 . Based on structural analysis, a bundle formed by NuoA, NuoJ, NuoK, and NuoH may collectively act as a proton pump machinery within the NDH-1 complex .

What are the recommended storage conditions for recombinant nuoK protein?

For optimal stability and activity of recombinant H. aurantiacus nuoK protein, the following storage conditions are recommended:

• Short-term storage: Store working aliquots at 4°C for up to one week .

• Long-term storage: Store at -20°C in a Tris-based buffer containing 50% glycerol that has been optimized for this specific protein .

• Extended storage: For periods longer than several months, store at -80°C .

To maintain protein integrity, avoid repeated freeze-thaw cycles as these can lead to protein denaturation and loss of activity . When working with the protein, it is advisable to prepare small working aliquots to minimize the need for repeated thawing of the stock solution.

How can site-directed mutagenesis be effectively used to study the functional domains of nuoK?

Site-directed mutagenesis is a powerful approach for investigating the functional significance of specific residues in nuoK. Based on successful experimental designs described in the literature:

• Target conserved residues: Focus on highly conserved residues, particularly charged amino acids like the glutamates at positions 36 and 72, which have been shown to be crucial for function .

• Systematic relocation strategy: Beyond simple alanine-scanning, consider systematically relocating key residues to nearby positions to understand the importance of their specific location. For example, shifting Glu-36 along TM2 to positions 32, 38, 39, and 40 has provided insights into the spatial requirements of this residue .

• Test multiple mutation types: For each position, test both conservative (e.g., Glu to Asp) and non-conservative (e.g., Glu to Ala or Gln) substitutions to distinguish between charge-dependent and structure-dependent effects .

• Analyze multiple functional parameters: Assess the effects of mutations on both electron transfer activity and proton pumping ability to understand the coupling mechanism .

What methodologies can be employed to assess the proton translocation function of nuoK?

Several complementary approaches can be used to investigate the proton translocation function of nuoK:

How do the conserved glutamate residues in nuoK contribute to the proton translocation mechanism?

The conserved glutamate residues in nuoK play crucial roles in the proton translocation mechanism of NDH-1:

• Glu-36 (TM2): This perfectly conserved residue is essential for energy transduction. Experimental data show that when this residue is shifted along TM2 to positions 32, 38, 39, and 40, the mutants largely retain energy-transducing NDH-1 activities . These positions are located in the vicinity of Glu-36, present in the same helix phase, immediately before and after a helix turn. This suggests that Glu-36 functions as a proton acceptor/donor, but its exact position can be somewhat flexible as long as it remains on the same face of the helix .

• Glu-72 (TM3): This almost perfectly conserved residue appears to have a supporting role. Mutations at this position cause partial loss of activity, indicating its involvement in, but not absolute requirement for, proton translocation .

The fact that these residues are positioned in the middle of adjacent transmembrane helices suggests they form part of a proton conduction pathway through the membrane domain of the enzyme .

What is the relationship between the small cytoplasmic loop (loop-1) of nuoK and its proton pumping function?

The small cytoplasmic loop (loop-1) connecting TM1 and TM2 of nuoK contains three key residues (25RRN27) that significantly impact the function of NDH-1:

• Double mutation of the two arginine residues (R25A/R26A) drastically reduces electron transfer rates and diminishes the electrochemical gradient, indicating their importance in energy coupling .

• These positively charged residues in the cytoplasmic loop may interact with negatively charged phospholipid headgroups or other subunits of the NDH-1 complex, helping to maintain the proper orientation of the transmembrane helices .

• The position of this loop at the cytoplasmic side of the membrane suggests it may play a role in proton uptake from the cytoplasm or in conformational changes that are required for the coupling of electron transfer to proton translocation .

How does nuoK compare to the MrpC subunit of multisubunit Na+/H+ antiporters?

• Conservation pattern: While the two key glutamate residues (Glu-36 and Glu-72) are highly conserved in nuoK across species, neither is conserved in the MrpC subunit of multisubunit Na+/H+ antiporters .

• Functional role: This difference in conservation pattern suggests that despite structural similarities, nuoK and MrpC may have evolved different mechanisms for ion translocation.

• Evolutionary implications: The structural similarity but functional divergence between nuoK and MrpC supports the hypothesis that complex I evolved from the fusion of a soluble NAD-reducing hydrogenase with a membrane-bound ion-translocating complex related to the Mrp antiporter .

This comparison provides insights into the evolutionary origins of the NDH-1 complex and how different ion-translocating modules may have been adapted for various bioenergetic functions.

How conserved is nuoK across different species of Herpetosiphon and other bacteria?

• Glu-36 in TM2 is perfectly conserved across all species examined .

• Glu-72 in TM3 is almost perfectly conserved across species .

Within the Herpetosiphon genus specifically, there are currently five known species: H. aurantiacus, H. geysericola, H. giganteus, H. gulosus, and the recently characterized H. llansteffanense . While genome analysis has shown considerable genetic diversity within this genus, components of essential energy-generating systems like NDH-1 (including nuoK) tend to be conserved in their key functional elements.

What insights does genomic analysis of Herpetosiphon aurantiacus provide about the functional context of nuoK?

Genomic analysis of H. aurantiacus provides several insights into the functional context of nuoK:

• H. aurantiacus is a chemoheterotrophic, filamentous gliding bacterium with predatory capabilities, using a "wolf pack" mechanism to prey on other microbes .

• The genome reveals diverse secondary metabolite biosynthetic clusters, which may work synergistically with energy-generating systems like NDH-1 to support the organism's predatory lifestyle .

• The nuoK gene (locus name: Haur_3214) is part of the nuo operon encoding all subunits of the NDH-1 complex, reflecting the coordinated expression of these functionally related proteins .

These genomic insights suggest that nuoK functions within a broader metabolic context that supports the unique ecological niche of H. aurantiacus as a predatory bacterium.

What are the unresolved questions regarding the proton translocation pathway involving nuoK?

Several key questions about nuoK's role in proton translocation remain unresolved:

• Proton entry/exit pathways: While Glu-36 and Glu-72 are clearly important for function, the complete proton translocation pathway through nuoK remains undefined. Future research should focus on identifying all residues involved in forming this pathway and how they interact during the catalytic cycle .

• Coupling mechanism: How exactly the conformational changes in nuoK couple electron transfer to proton translocation requires further investigation, particularly the sequence of events and energy transduction mechanism .

• Interactions with other subunits: While nuoK is known to interact extensively with NuoN and functionally cooperate with NuoA and NuoJ, the molecular details of these interactions and how they contribute to proton pumping need further elucidation .

What novel methodological approaches could advance our understanding of nuoK function?

Several cutting-edge approaches could significantly advance our understanding of nuoK function:

• Time-resolved structural methods: Techniques like time-resolved cryo-EM or time-resolved X-ray crystallography could capture different conformational states of nuoK during the catalytic cycle.

• Computational approaches: Molecular dynamics simulations and quantum mechanical/molecular mechanical (QM/MM) calculations could provide insights into proton movement through the nuoK subunit and energetics of different protonation states.

• Single-molecule techniques: Methods like single-molecule FRET could monitor conformational changes in nuoK in real-time during electron transfer and proton pumping.

• Synthetic biology approaches: Creation of minimal functional models of nuoK or chimeric proteins combining elements from nuoK and related proteins like MrpC could help identify the essential structural elements required for function.

How might insights from nuoK research be applied to understanding mitochondrial complex I disorders?

Research on bacterial nuoK (homologous to mitochondrial ND4L) has significant implications for understanding human mitochondrial disorders: