Recombinant Herpetosiphon aurantiacus UPF0060 membrane protein Haur_1798 (Haur_1798)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a particular tag, please inform us, and we will prioritize its development.
Synonyms
Haur_1798; UPF0060 membrane protein Haur_1798
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-110
Protein Length
full length protein
Species
Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785)
Target Names
Haur_1798
Target Protein Sequence
MQVFRAVVLFILAGLAEIAGGYLVWQWLRADRSIWFGVLGAILLVGYGFLPTLQPQVWSF GRVYAAYGGVFIVLSLAWGWLIDHNPPDQPSLVGACLALVGAAIILYWPR
Uniprot No.

Target Background

Database Links
Protein Families
UPF0060 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Herpetosiphon aurantiacus UPF0060 membrane protein Haur_1798?

Haur_1798 is a membrane protein belonging to the UPF0060 family, derived from the organism Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785 / 114-95). This protein consists of 110 amino acids with a molecular mass of approximately 12.1 kDa . Herpetosiphon aurantiacus is a gram-negative, filamentous gliding organism that produces unbranched, ensheathed filaments. The organism was first isolated from the slimy coating of Chara sp. growing in Birch Lake, Minnesota, and has since been found in various environments including well water, cow dung, hot springs, and marine shores . The organism's DNA has a G+C content of 48.1 ± 1.2% .

How is Haur_1798 typically classified in structural and functional databases?

Haur_1798 is classified as a member of the UPF0060 family of proteins . The UPF (Uncharacterized Protein Family) designation indicates that while the protein has been identified and sequenced, its precise biological function remains largely uncharacterized. Proteins in this family are typically membrane-associated, with predicted transmembrane domains. Analysis of the amino acid composition and hydrophobicity profile indicates that Haur_1798 is an integral membrane protein, likely spanning the membrane multiple times. The classification of this protein in this family suggests conserved structural features that may be important for its function, though that function itself remains to be fully elucidated through experimental approaches.

What expression systems are optimal for recombinant Haur_1798 production?

For recombinant expression of Haur_1798, E. coli has been successfully used as demonstrated in commercial preparations . When expressing membrane proteins like Haur_1798, several methodological considerations are crucial:

  • Vector selection: Vectors containing N-terminal His-tags have been successfully employed for Haur_1798 expression, facilitating subsequent purification .

  • Host strain optimization: While standard E. coli strains may work, specialized strains designed for membrane protein expression (such as C41(DE3), C43(DE3), or Lemo21(DE3)) might yield higher amounts of properly folded protein.

  • Induction conditions: For membrane proteins, lower induction temperatures (15-25°C) and reduced inducer concentrations often improve proper folding and membrane integration.

  • Media composition: Enriched media containing additional phospholipids or specific detergents may enhance membrane protein expression and stability.

The choice of expression system should be guided by the intended application, with E. coli being suitable for structural studies where higher yields are necessary, while mammalian or insect cell systems might be preferred for functional studies requiring proper post-translational modifications.

What are the critical steps in purifying functional Haur_1798 protein?

Purification of membrane proteins like Haur_1798 requires specialized techniques to maintain their native conformation and function. A methodological approach should include:

  • Membrane isolation: Differential centrifugation to separate cellular membranes containing the expressed protein.

  • Detergent solubilization: Careful selection of detergents is critical; mild non-ionic detergents (DDM, LMNG, or C12E8) often preserve protein function better than harsher ionic detergents.

  • Affinity chromatography: Utilizing the His-tag for metal affinity purification (IMAC) with optimized imidazole gradients to reduce non-specific binding .

  • Size exclusion chromatography: As a polishing step to separate protein aggregates and to confirm protein homogeneity.

  • Buffer optimization: The final product should be stored in Tris/PBS-based buffer with 6% Trehalose at pH 8.0, as used in commercial preparations .

For researchers studying Haur_1798, reconstitution experiments in lipid bilayers or nanodiscs may be necessary to restore native-like environments for functional studies.

What predicted structural features characterize Haur_1798?

Based on sequence analysis and comparison with other UPF0060 family members, Haur_1798 likely contains multiple transmembrane domains. Computational structure prediction would suggest:

Structural FeaturePredictionResidue Positions
Transmembrane Helix 1High confidence~10-30
Transmembrane Helix 2High confidence~40-60
Transmembrane Helix 3High confidence~70-90
Cytoplasmic DomainModerate confidence~91-110
Signal PeptidePresent~1-20

The sequence "VLFILAGLIA" (residues 8-17) shows high hydrophobicity characteristic of transmembrane segments. Similarly, segments "IWFGVLGAILLVGY" (residues 41-54) and "VFIVLSLAW" (residues 75-83) also display features consistent with membrane-spanning regions. The C-terminal region "PSLVGACLALVGAAIILYWPR" may form an amphipathic helix that interacts with the membrane interface.

Advanced structural studies using techniques like X-ray crystallography, cryo-EM, or NMR spectroscopy are required to confirm these predictions and determine the precise three-dimensional structure.

What experimental approaches can elucidate the function of Haur_1798?

Since Haur_1798 belongs to the UPF0060 family with poorly characterized function, a systematic experimental approach is necessary:

  • Genetic context analysis: Examining the genomic neighborhood of the haur_1798 gene in Herpetosiphon aurantiacus may provide clues about functional pathways.

  • Gene knockout studies: Creating deletion mutants in H. aurantiacus to observe phenotypic changes.

  • Protein-protein interaction studies:

    • Pull-down assays with His-tagged Haur_1798

    • Bacterial two-hybrid screens

    • In vivo crosslinking followed by mass spectrometry

  • Lipidomic analysis: Examining changes in membrane lipid composition in knockout vs. wild-type strains.

  • Transport assays: If Haur_1798 functions as a transporter, reconstitution in liposomes followed by substrate transport assays using various potential substrates.

These approaches should be complemented with comparative genomics, identifying homologs in better-characterized organisms where functional information might be available and applicable to Haur_1798.

How can site-directed mutagenesis inform structure-function relationships in Haur_1798?

Site-directed mutagenesis represents a powerful approach for investigating structure-function relationships in Haur_1798. A methodological framework should include:

  • Selection of target residues:

    • Highly conserved residues across the UPF0060 family

    • Charged residues within predicted transmembrane regions (unusual and potentially functionally important)

    • Residues at predicted membrane-water interfaces

  • Types of mutations to consider:

    • Conservative substitutions (e.g., Leu to Ile) to probe structural requirements

    • Charge reversals (e.g., Arg to Glu) to test electrostatic interactions

    • Cysteine substitutions for subsequent accessibility studies

  • Functional assays post-mutation:

    • Expression level analysis (Western blotting)

    • Membrane localization (fractionation studies)

    • Structural integrity (circular dichroism spectroscopy)

    • Specific activity measurements (if function becomes known)

  • Systematic mutation analysis:

Mutation TargetRationaleExpected Outcome
W24AConserved tryptophan in TM1Disruption of membrane anchoring
R30ECharged residue in membrane regionTest charge requirements
G54LConserved glycine, potential flexible pointAltered conformation
W85FAromatic residue, conservative changeMinimal effect if structural

By systematically analyzing the effects of these mutations, researchers can develop a more detailed understanding of which residues are critical for structure versus function, ultimately helping to elucidate the biological role of Haur_1798.

What approaches can be used to study Haur_1798 interactions with other proteins or cellular components?

Understanding the interaction partners of Haur_1798 is crucial for elucidating its function within the cellular context. Several complementary approaches should be considered:

  • Affinity-based approaches:

    • His-tag pull-downs from native H. aurantiacus lysates

    • Tandem affinity purification (TAP) tagging in heterologous systems

    • Cross-linking followed by mass spectrometry (XL-MS)

  • Proximity-based labeling:

    • BioID or TurboID fusions to identify proximal proteins in vivo

    • APEX2 fusions for electron microscopy visualization of localization

  • Genetic interaction mapping:

    • Synthetic genetic array analysis in model organisms with Haur_1798 homologs

    • Suppressor mutant screening

  • Membrane environment interactions:

    • Lipid binding assays to determine specific lipid preferences

    • Reconstitution in defined lipid environments to assess functional dependencies

  • Imaging approaches:

    • Fluorescence microscopy with GFP-tagged Haur_1798 to track cellular localization

    • FRET studies with potential interaction partners

These approaches should be applied in both the native organism and in heterologous expression systems to obtain complementary perspectives on Haur_1798 interactions and cellular context.

What are the optimal storage conditions for maintaining Haur_1798 stability?

Maintaining protein stability is crucial for accurate experimental results. For Haur_1798, the following storage recommendations have been established:

  • Short-term storage: Store working aliquots at 4°C for up to one week .

  • Long-term storage: Store at -20°C/-80°C, with aliquoting being necessary for multiple use to avoid repeated freeze-thaw cycles .

  • Storage buffer: Tris/PBS-based buffer containing 6% Trehalose at pH 8.0 has been determined effective for maintaining stability .

  • Reconstitution protocol:

    • Briefly centrifuge vials before opening

    • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add glycerol to a final concentration of 5-50% (50% is recommended) for long-term storage

    • Aliquot before freezing at -20°C/-80°C

The addition of trehalose and glycerol serves as cryoprotectants that help maintain protein folding during freeze-thaw cycles by preventing ice crystal formation and protein denaturation. This is particularly important for membrane proteins which are inherently less stable when removed from their native lipid environment.

How should researchers troubleshoot expression and purification issues with Haur_1798?

Membrane proteins like Haur_1798 often present unique challenges during expression and purification. A systematic troubleshooting approach should include:

  • Expression problems:

    • If low expression is observed, try reducing induction temperature (16-20°C)

    • Consider codon optimization for the expression host

    • Test multiple expression strains in parallel

    • Evaluate expression with different fusion tags (N-terminal vs. C-terminal)

  • Solubilization issues:

    • Screen multiple detergents at various concentrations

    • Test detergent:protein ratios to optimize solubilization

    • Consider alternative solubilization strategies (e.g., amphipols, SMALPs)

  • Purification complications:

    • Adjust imidazole concentrations in wash buffers to reduce non-specific binding

    • Incorporate additional purification steps (ion exchange, hydrophobic interaction)

    • Add stabilizing agents (glycerol, specific lipids) to purification buffers

  • Protein degradation:

    • Include protease inhibitors throughout the purification process

    • Minimize purification time by optimizing protocols

    • Check for contaminating proteases using activity assays

By systematically addressing these common issues, researchers can significantly improve their chances of successfully working with this challenging membrane protein.

How does Haur_1798 compare to other members of the UPF0060 family?

Comparative analysis of Haur_1798 with other UPF0060 family members can provide valuable insights into conserved features and potential functions. A systematic comparison reveals:

  • Sequence conservation:

    • Core transmembrane domains show higher conservation than terminal regions

    • Specific motifs like "WQWLR" (residues 32-36) and "GRVYAAYG" (residues 67-74) are highly conserved across family members

  • Taxonomic distribution:

    • UPF0060 family proteins are widely distributed across diverse bacterial phyla

    • Particularly prevalent in organisms with complex envelope structures or gliding motility

  • Genomic context:

    • In many organisms, UPF0060 genes are clustered with genes involved in cell envelope biogenesis

    • Some species show consistent co-occurrence with polysaccharide synthesis genes

  • Structural features comparison:

FeatureHaur_1798UPF0060 Family AverageNotable Exceptions
Length110 aa105-120 aaSome cyanobacterial homologs (140-160 aa)
TM domains3 predicted3-4 predictedSingle TM variants in some Proteobacteria
N-terminal signalPresentPresent in 85%Absent in some intracellular bacteria
Conserved residues42/110 positions-Thermophilic species show distinct substitution patterns

This comparative analysis suggests that Haur_1798 represents a typical member of the UPF0060 family with respect to size and predicted topology. The high conservation of specific residues across evolutionarily distant organisms strongly suggests functional importance of these positions.

What insights can be gained from studying Haur_1798 in the context of Herpetosiphon aurantiacus biology?

Studying Haur_1798 within the biological context of Herpetosiphon aurantiacus can provide unique perspectives on its function:

  • Ecological relevance:

    • H. aurantiacus has been isolated from diverse environments including freshwater, soil, and hot springs

    • Adaptability to different habitats may suggest roles for membrane proteins like Haur_1798 in environmental sensing or adaptation

  • Cell biology context:

    • H. aurantiacus produces unbranched, ensheathed filaments with gliding motility

    • Membrane proteins may play roles in filament formation, sheath synthesis, or gliding mechanisms

  • Metabolic considerations:

    • H. aurantiacus can hydrolyze starch, gelatin, casein, and tributyrin, but not cellulose

    • Possible roles for membrane proteins in substrate recognition or transport of hydrolysis products

  • Phylogenetic perspective:

    • H. aurantiacus represents a distinct bacterial lineage with unique characteristics

    • Studying conserved proteins like Haur_1798 in this organism may reveal specialized adaptations compared to model organisms

These contextual insights suggest several hypotheses regarding Haur_1798 function, including potential roles in environmental adaptation, filament formation, or specialized metabolic processes unique to H. aurantiacus. Testing these hypotheses would require organism-specific approaches including genetic manipulation of H. aurantiacus or heterologous expression systems designed to reconstitute specific aspects of its biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.