Recombinant Heterodontus francisci Ig heavy chain C region, membrane-bound form

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Heterodontus francisci Ig Heavy Chain C Region, Membrane-Bound Form

The Recombinant Heterodontus francisci Ig heavy chain C region, membrane-bound form is a protein derived from the horned shark, Heterodontus francisci. This compound is of significant interest in immunological research due to its unique characteristics and evolutionary implications. The horned shark, being a phylogenetically primitive vertebrate, offers insights into the early development of the vertebrate immune system.

Background on Immunoglobulins in Heterodontus francisci

Immunoglobulins (Ig) are crucial components of the vertebrate immune system, consisting of heavy and light chains. In Heterodontus francisci, the organization of Ig genes is distinct compared to mammals. The heavy chain genes, including the constant region (CH), show similarities with mammalian prototypes in terms of exon and intron organization but lack the DNA sequences associated with heavy chain class switching found in mammals .

Characteristics of Recombinant Heterodontus francisci Ig Heavy Chain C Region

  • Source and Host: This recombinant protein is typically produced in Escherichia coli (E. coli) and is His-tagged for purification and identification purposes .

  • Function: The Ig heavy chain C region plays a critical role in the structure and function of antibodies, influencing their effector functions and interactions with other immune components.

  • Pathways and Interactions: The membrane-bound form of this protein is involved in several immune-related pathways and interacts with various proteins and molecules, contributing to the immune response .

Genomic Organization

The genomic organization of Ig genes in Heterodontus francisci shows unique features, such as close linkage between VH, DH, JH, and CH segments, which contrasts with the more dispersed organization in mammals . This close linkage may limit combinatorial diversity in antibody production.

Evolutionary Significance

Studies on Heterodontus francisci Ig genes provide insights into the evolution of the vertebrate immune system. The conservation of certain sequences and structures across species highlights the importance of these elements in immune function .

Potential Applications

While specific applications of the Recombinant Heterodontus francisci Ig heavy chain C region, membrane-bound form are not widely documented, research into such proteins can contribute to understanding immune system evolution and potentially inform the development of novel immunotherapies.

Pathways and Functions

Pathway NamePathway Related Protein
Immune ResponseVarious immune receptors
FunctionRelated Protein
Antibody Effector FunctionsComplement proteins, Fc receptors

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes if needed. We will fulfill requests whenever possible.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping is available upon request with an additional charge. Please contact us in advance to arrange this.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may be used as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is finalized during production. If you require a particular tag, please inform us, and we will prioritize its development.
Synonyms
Ig heavy chain C region, membrane-bound form; Clone 3050
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-461
Protein Length
full length protein
Species
Heterodontus francisci (Horn shark) (Cestracion francisci)
Target Protein Sequence
ATPSPPTLYGLCSCEQPNTDGSLAYGCLAMDYIPQITSVSWKKDNEPITTGLKTYPSVLN KKGTYTQSSQLTITESEVGSSKIYCEVRRGESVWIKEIPDCKGDKVHPTVILTQSSSEEI TSRRFATVLCSIIDFHPESITVSWLKDGQHMESGFVTSPTCGVNGTFSATSRLTVPAREW FTNKVYTCQVSHQGVTQSRNITGSQVPCSCNDPVIKLLPPSIEQVLLEATVTLTCVVSNA PYGVNVSWTQEQKSLKSEIAVQPGEDADSVISTVNISTQAWLSGAEFYCVVNHQDLPTPL RASIHKEEVKDLREPSVSILLSPAEDVSAQRFLSLTCLVRGFFPREIFVKWTVNDKSVNP GNYKNTEVMAENDNSSYFIYSLLSIAAEEWASGASYSCVVGHEAIPLKIINRTVNKSSDS SDHIWIEDNEEESAIDNASTFIILFFLSIFYRAAVTLVKVK
Uniprot No.

Target Background

Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is Heterodontus francisci Ig heavy chain C region and why is it significant in evolutionary immunology?

The Heterodontus francisci (horned shark) immunoglobulin heavy chain C region represents one of the most phylogenetically primitive vertebrate antibody structures available for study. Its significance stems from several unique characteristics:

The immunoglobulin gene organization in H. francisci is distinct from higher vertebrates, with VH (variable), DH (diversity), JH (joining), and CH (constant) gene segments arranged in multiple individual clusters rather than the sequential arrangement seen in mammals . This clustering pattern includes three identified organizational configurations:

  • VH-D1-D2-JH-CH with unique 12/22 and 12/12 spacers in respective D recombination signal sequences

  • VHDH-JH-CH, a germline configuration with joined VH and DH segments

  • VHDHJH-CH, with all segmental elements joined

H. francisci lacks a heavy chain class shift mechanism and elicits hapten-specific antibody responses without interindividual variation or affinity maturation, making it a crucial model for understanding the evolutionary development of adaptive immunity . These characteristics suggest that H. francisci represents an early evolutionary stage of the vertebrate immune system, providing insights into the ancestral structure of antigen-binding receptor genes.

How does the membrane-bound form of Heterodontus francisci Ig heavy chain C region differ from the secreted form?

The membrane-bound and secreted forms of H. francisci Ig heavy chain C region represent alternative products from the same gene family, differentiated primarily by their C-terminal domains and post-transcriptional processing:

FeatureMembrane-Bound FormSecreted Form
Protein Length461 amino acids Shorter than membrane-bound form
UniProt IDP23088 Different ID
C-terminal DomainContains hydrophobic transmembrane region Lacks transmembrane domain
SplicingResults from differential splicing of mRNA Alternative splicing product
FunctionCell surface receptorSecreted antibody
Expression LevelmRNAs encoding TM Ig are "exceedingly rare" More abundant than membrane-bound form

The differential splicing mechanism that produces these two forms appears conserved from sharks to mammals, with sequences involved in differential splicing of secretory and transmembrane mRNA showing similarities to mammalian patterns . Analysis of spleen cDNA libraries and RNA blot analyses indicates that mRNAs encoding the transmembrane form are considerably less abundant than the secreted form, suggesting potential regulatory differences .

What is the structural organization of Heterodontus francisci immunoglobulin genes compared to mammalian equivalents?

The H. francisci immunoglobulin gene organization presents several distinctive features compared to mammalian counterparts:

FeatureH. francisciMammals
Gene ArrangementMultiple individual clusters containing VH-D-J-C elements V genes in one cluster, D-J-C in another
Intron LengthUniformly longer introns Shorter introns
Class SwitchingAbsent; lacks DNA sequences for heavy chain class switching Present with multiple heavy chain isotypes
Gene Family SizeMultiple VH genes with varying FR segments Large families of V genes
D Segment ConfigurationSome genes contain two D segments (D1-D2) with unique spacer arrangements Typically single D segments

The complete sequence analysis of H. francisci CH regions shows differences between individual CH genes in all exons . While sharing similarities in exon and intron organization with mammalian μ-type genes, H. francisci lacks the DNA sequences implicated in heavy chain class switching found in mammals .

This unique clustered arrangement in which each functional unit contains all elements required for antibody production (VH-D-J-C) may represent a more ancestral configuration than the split arrangement found in higher vertebrates .

What methods are used to express recombinant Heterodontus francisci Ig heavy chain proteins in laboratory settings?

Researchers typically employ several expression systems for producing recombinant H. francisci Ig heavy chain proteins:

Expression Systems:

  • E. coli expression system: Most commonly reported for full-length protein production

  • Alternative systems including yeast, baculovirus, or mammalian cells can be used depending on research requirements

Methods for Optimal Expression:

  • Cloning strategy: The complete coding sequence (positions 1-461 for the full-length membrane-bound form) is typically inserted into an expression vector with an appropriate tag (commonly His-tag)

  • Protein purification: Techniques include affinity chromatography using the His-tag for capture

  • Quality control: SDS-PAGE analysis to confirm purity (greater than 90% purity is standard)

Storage and Handling:

  • Recommended storage in Tris/PBS-based buffer with 6% trehalose at pH 8.0

  • For long-term storage, aliquoting with 5-50% glycerol and storing at -20°C/-80°C

  • Reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Working aliquots can be stored at 4°C for up to one week

Repeated freeze-thaw cycles should be avoided to maintain protein stability and activity .

How can researchers verify the purity and functionality of recombinant Heterodontus francisci Ig heavy chain proteins?

Verification of recombinant H. francisci Ig heavy chain protein quality involves multiple analytical approaches:

Purity Assessment:

  • SDS-PAGE analysis: Standard method to verify protein size and purity, with >90% purity being typical for research applications

  • Western blotting: Can confirm identity using antibodies against the protein or tag

  • HPLC analysis: For higher resolution purity assessment

Structural Verification:

  • Mass spectrometry: To confirm the exact molecular weight and potential post-translational modifications

  • Amino acid sequencing: Partial sequencing can verify the protein matches the expected sequence

  • Comparing the amino acid sequence with the established 461-amino acid sequence from UniProt (P23088)

Functional Verification:

  • Binding assays: To confirm that the recombinant protein retains expected binding properties

  • Comparative analysis: With naturally derived protein where possible

  • RNA blot analyses: Similar to those performed with homologous VH probes and synthetic oligodeoxynucleotide probes complementing portions of the constant region

The specific functional verification methods will depend on the intended research application of the recombinant protein.

What experimental approaches are recommended for studying the binding properties of Heterodontus francisci Ig heavy chain C region?

Advanced experimental approaches for studying binding properties of H. francisci Ig heavy chain C region include:

Binding Characterization Methods:

  • Surface Plasmon Resonance (SPR): For real-time binding kinetics measurements

  • Enzyme-Linked Immunosorbent Assay (ELISA): To study specific binding interactions

  • Isothermal Titration Calorimetry (ITC): For thermodynamic characterization of binding

  • Biolayer Interferometry: Alternative to SPR for binding analysis

Structural Studies:

  • X-ray crystallography: To determine high-resolution three-dimensional structure

  • Nuclear Magnetic Resonance (NMR): For solution-state structural studies

  • Cryo-electron microscopy: For larger complexes

Comparative Approaches:

  • In vitro binding assays comparing H. francisci Ig with counterparts from other species

  • Domain swapping experiments to identify functional regions

  • Site-directed mutagenesis of conserved residues to assess their importance in binding

The experimental designs should account for the primitive nature of this immunoglobulin and incorporate appropriate controls from more evolutionary advanced species. RNA blot analyses with homologous VH probes and synthetic oligodeoxynucleotide probes have been successfully used to study expression patterns and could be adapted for binding studies .

How can researchers use Heterodontus francisci Ig heavy chain studies to understand the evolution of adaptive immunity?

H. francisci Ig heavy chain studies provide critical insights into the evolutionary development of adaptive immunity:

Evolutionary Comparative Approaches:

  • Sequence comparison across species: Aligning H. francisci sequences with those from other cartilaginous fish (like Carcharhinus plumbeus) and higher vertebrates to track evolutionary changes

  • Phylogenetic analysis: Constructing evolutionary trees based on Ig sequences to establish relationships between shark and other vertebrate immunoglobulins

  • Structural analysis: Comparing three-dimensional structures to identify conserved functional domains versus evolutionarily plastic regions

Key Research Questions:

  • How the clustered VH-D-J-C gene arrangement in H. francisci evolved into the split arrangement in higher vertebrates

  • Whether the diverse organization patterns (VH-D1-D2-JH-CH, VHDH-JH-CH, and VHDHJH-CH) represent evolutionary intermediates or specialized adaptations

  • The evolutionary significance of the unique recombination signal sequences with 12/22 and 12/12 spacers in H. francisci D segments

The H. francisci immune system exhibits characteristics of both mammalian immunoglobulins and T-cell receptors, suggesting it may reflect the structure of a common ancestral antigen binding receptor gene . Comparative studies between H. francisci and other shark species like Carcharhinus plumbeus (sandbar shark) can reveal immune system changes over approximately 180 million years of evolution .

What are the key considerations when comparing Heterodontus francisci Ig sequences with those from other cartilaginous fish or higher vertebrates?

When comparing H. francisci Ig sequences with other species, researchers should consider:

Sequence Analysis Considerations:

  • Alignment strategies: Accounting for insertions/deletions in variable regions while preserving functionally important residues

  • Domain-specific comparison: Analyzing variable, diversity, joining, and constant regions separately

  • Conservation metrics: Examining both percent identity and physiochemical property conservation

Structural Elements to Focus On:

  • Framework regions (FRs): Often more conserved across species

  • Complementarity determining regions (CDRs): Typically more variable but may contain conserved structural elements

  • Transmembrane domains: In membrane-bound forms

  • Splice junctions: For comparing differential processing of membrane-bound versus secreted forms

Evolutionary Context:

  • The position of H. francisci as representing "earliest level of evolutionary development in which immunoglobulins resembling mammalian antibodies have been unequivocally demonstrated"

  • The lack of interindividual variation and affinity maturation in H. francisci antibody responses compared to higher vertebrates

  • The potential impact of the "paucity of germline V genes as well as the absence of somatic mutation-recombination effects"

Metric analysis of complete sequences has shown "striking organizational homology and nucleotide identity with mammalian prototype VH genes" despite the evolutionary distance , underscoring the value of careful comparative approaches.

How do post-translational modifications affect the functionality of Heterodontus francisci Ig heavy chain proteins in research applications?

Post-translational modifications (PTMs) significantly impact the functionality of H. francisci Ig heavy chain proteins:

Common PTMs and Their Effects:

  • Glycosylation: Affects protein folding, stability, and potential binding interactions

  • Disulfide bonding: Critical for tertiary structure and stability of immunoglobulins

  • Phosphorylation: May regulate signaling functions in membrane-bound forms

Expression System Considerations:

Expression SystemPTM CapabilitiesLimitations for H. francisci Ig Research
E. coliLimited; no glycosylationMay not reproduce all native PTMs
YeastSome glycosylation but patterns differ from vertebratesHyperglycosylation may occur
Mammalian cellsClosest to native vertebrate PTMsMore complex and expensive system
BaculovirusIntermediate complexity PTMsInsect cell patterns differ from vertebrates

Research Implications:

  • Functional studies may be affected if critical PTMs are absent in recombinant proteins

  • Structural studies need to account for differences between recombinant and native proteins

  • Cross-species reactivity tests should consider PTM differences

Researchers should select expression systems based on the specific requirements of their experimental applications, particularly when studying functional aspects that might depend on specific PTMs .

What are the challenges in interpreting contradictory results when studying ancient adaptive immune systems like that of Heterodontus francisci?

Researchers face several challenges when interpreting contradictory results in H. francisci immunoglobulin studies:

Common Sources of Contradiction:

  • Evolutionary context misinterpretation: Applying mammalian-centric models to ancient systems

  • Technical limitations: Different expression systems or analytical methods yielding inconsistent results

  • Sample variation: Individual variation within H. francisci populations or developmental differences

  • Functional equivalence assumptions: Presuming structural similarity indicates functional similarity

Reconciliation Approaches:

  • Multiple method validation: Using complementary techniques to verify findings

  • Cross-species comparisons: Examining patterns across multiple cartilaginous fish species

  • Evolutionary trajectory analysis: Considering results in context of adaptive immune system evolution

  • Functional testing: Moving beyond sequence/structure to examine actual binding capabilities

Specific H. francisci Challenges:

  • The unique germline VH gene pool complexity contrasts with the apparent lack of antibody diversity in functional responses

  • The presence of multiple organizational patterns (VH-D1-D2-JH-CH, VHDH-JH-CH, VHDHJH-CH) raises questions about their functional significance

  • Findings of "exceedingly rare" mRNAs encoding transmembrane Ig conflict with expectations about cell-surface receptor requirements

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.