Recombinant Heterosigma akashiwo ATP synthase subunit b, chloroplastic (atpF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a particular tag, please specify it in your order; we will prioritize its development.
Synonyms
atpF; Heak452_Cp079; ATP synthase subunit b, chloroplastic; ATP synthase F(0 sector subunit b; ATPase subunit I
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-182
Protein Length
full length protein
Species
Heterosigma akashiwo (strain CCMP452)
Target Names
atpF
Target Protein Sequence
MENLTNIFLFLSNENEGIQLNTDIFEANIINLALLIVLVINVAKDVLGSILSARKASILD KIEEADKKLNEADKRFTEARLQWSQANIFGEDLEKKTYQRINAFHESQNLKNKDALLREY FSTLVVLDLKNEQVQKQVRNYVMELALIEVYGVFTKLVANKKFQENYSNYSVLLLEKLIG EK
Uniprot No.

Target Background

Function

F(1)F(0) ATP synthase synthesizes ATP from ADP utilizing a proton or sodium gradient. This enzyme comprises two domains: the F(1) domain, containing the extramembranous catalytic core, and the F(0) domain, housing the membrane proton channel. These domains are connected by a central stalk and a peripheral stalk. ATP synthesis within the F(1) catalytic domain is coupled, via a rotary mechanism of the central stalk subunits, to proton translocation. This protein is a component of the F(0) channel and forms part of the peripheral stalk, linking F(1) and F(0).

Protein Families
ATPase B chain family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

How does H. akashiwo ATP synthase subunit b compare to homologous proteins in other species?

Comparative analysis of H. akashiwo ATP synthase subunit b with homologous proteins from other photosynthetic organisms reveals both conserved and variable regions. The protein shares structural and functional similarities with ATP synthase subunit b from other algae and plants, particularly in the transmembrane domains and regions involved in interactions with other ATP synthase components.

Analysis of the sequence reveals several characteristic features:

  • N-terminal region: Likely contains the chloroplast transit peptide necessary for targeting the nuclear-encoded protein to the chloroplast. Transit peptides typically show less sequence conservation between species while maintaining similar physicochemical properties .

  • Transmembrane domain: Contains hydrophobic regions essential for anchoring the protein in the thylakoid membrane.

  • C-terminal domain: Involved in interactions with other ATP synthase subunits, particularly those in the F₁ sector.

The gene encoding this protein in H. akashiwo has been identified as atpF (locus Heak293_Cp079) . In contrast to higher plants where the atpF gene is typically located in the chloroplast genome and may contain introns, the specific genomic organization in H. akashiwo would require further investigation.

To fully characterize the evolutionary relationships and functional conservation, researchers would need to conduct detailed phylogenetic analyses comparing H. akashiwo ATP synthase subunit b with homologs from related raphidophytes, other algal lineages, and higher plants.

What bioinformatics tools are most effective for analyzing H. akashiwo ATP synthase subunit b?

For comprehensive analysis of H. akashiwo ATP synthase subunit b, researchers should employ multiple complementary bioinformatics approaches:

Sequence Analysis Tools:

  • BLAST (Basic Local Alignment Search Tool): Essential for identifying homologous proteins across species

  • Clustal Omega or MUSCLE: For multiple sequence alignment to identify conserved regions

  • MEGA X: For constructing phylogenetic trees to understand evolutionary relationships

  • ExPASy ProtParam: For analyzing physicochemical properties including hydrophobicity, charge distribution, and theoretical pI

Structural Prediction Tools:

  • PSIPRED: For secondary structure prediction (alpha helices, beta sheets)

  • TMHMM or TOPCONS: Critical for transmembrane domain prediction in this membrane protein

  • SignalP and ChloroP: Essential for predicting signal peptides and chloroplast transit peptides

  • AlphaFold or I-TASSER: For generating tertiary structure predictions

Functional Analysis Tools:

  • InterProScan: For identifying functional domains and motifs

  • ConSurf: For mapping conservation onto structural models to identify functionally important residues

  • STRING: For predicting protein-protein interaction networks

  • KEGG Pathway analysis: For contextualizing the protein within metabolic pathways

When applying these tools to H. akashiwo ATP synthase subunit b, researchers should pay particular attention to:

  • The N-terminal region containing the putative chloroplast transit peptide

  • Conserved residues that may participate in interactions with other ATP synthase subunits

  • Transmembrane regions that anchor the protein in the thylakoid membrane

  • Unique sequence features that might reflect adaptation to the marine environment

A systematic bioinformatic analysis provides the foundation for designing wet-lab experiments to further characterize this protein's structure and function.

What are the optimal conditions for recombinant expression of H. akashiwo ATP synthase subunit b?

Recombinant expression of membrane proteins like H. akashiwo ATP synthase subunit b presents significant challenges. Based on successful approaches with similar proteins, researchers should consider several expression strategies:

E. coli Expression System:
This approach has proven successful for chloroplast ATP synthase subunits and offers several advantages:

  • BL21(DE3) derivative strains have successfully expressed eukaryotic membrane proteins

  • Codon optimization of the gene is essential for efficient expression

  • Expression as a fusion protein significantly improves solubility and yield

A recommended protocol based on successful expression of other chloroplast ATP synthase subunits would include:

  • Gene design and cloning:

    • Codon optimization for E. coli expression

    • Cloning into a vector with a solubility-enhancing fusion partner (MBP, SUMO)

    • Inclusion of a precision protease cleavage site between the fusion partner and target protein

  • Expression conditions:

    • Transform into BL21(DE3) or specialized membrane protein expression strains (C41/C43)

    • Culture growth at 37°C until mid-log phase (OD₆₀₀ ~0.6-0.8)

    • Temperature reduction to 18-20°C before induction

    • Induction with low IPTG concentration (0.1-0.5 mM)

    • Extended expression period (16-20 hours)

This approach mirrors the successful strategy used for chloroplast ATP synthase subunit c, which was expressed as a soluble MBP-fusion protein in E. coli, then cleaved and purified .

Alternative Expression Systems:
For cases where E. coli expression is problematic:

  • Yeast systems (P. pastoris):

    • Better equipped for eukaryotic protein folding

    • Can be optimized for membrane protein expression

    • Inducible promoters allow controlled expression

  • Insect cell/baculovirus system:

    • Excellent for complex membrane proteins

    • More native-like membrane environment

    • Higher cost but potentially better protein quality

The choice of expression system should be guided by the specific experimental goals, with E. coli being the first choice for structural studies requiring high protein yield, while eukaryotic systems might be preferred when proper folding is critical.

What purification strategies yield the highest purity of H. akashiwo ATP synthase subunit b?

Purification of recombinant H. akashiwo ATP synthase subunit b requires a multi-step approach optimized for membrane proteins:

Initial Extraction and Solubilization:

  • Cell lysis: Sonication or French press in buffer containing protease inhibitors

  • Membrane isolation: Low-speed centrifugation to remove debris followed by ultracentrifugation

  • Detergent solubilization: Screen detergents (DDM, LDAO, Triton X-100) for optimal solubilization while maintaining protein structure

Multi-step Purification Protocol:
For a fusion protein approach (similar to that used for ATP synthase subunit c) :

  • Affinity chromatography:

    • For MBP fusion: Amylose resin chromatography

    • For His-tagged constructs: Immobilized metal affinity chromatography (IMAC)

    • Careful optimization of wash steps to remove contaminants

  • Fusion tag cleavage:

    • Site-specific protease treatment (TEV, Factor Xa, or Precision protease)

    • Optimization of cleavage conditions to maintain protein stability

    • Second affinity step to remove the cleaved tag

  • Secondary purification:

    • Reversed-phase chromatography has been successfully applied to hydrophobic ATP synthase subunits

    • Size exclusion chromatography to separate oligomeric states and remove aggregates

    • Ion exchange chromatography for final polishing if necessary

  • Quality control:

    • SDS-PAGE analysis to assess purity (>95% purity target)

    • Mass spectrometry to confirm identity

    • Circular dichroism to verify proper secondary structure (predominantly alpha-helical)

This approach has been validated for similar membrane proteins, yielding "significant quantities of highly purified subunit" with verified secondary structure .

How can researchers assess the structure and function of purified H. akashiwo ATP synthase subunit b?

Comprehensive assessment of purified H. akashiwo ATP synthase subunit b requires multiple complementary approaches:

Structural Assessment:

  • Secondary structure analysis:

    • Circular dichroism (CD) spectroscopy to confirm alpha-helical content

    • Fourier-transform infrared spectroscopy (FTIR) as a complementary approach

    • Thermal stability assays to determine melting temperature

  • Tertiary structure evaluation:

    • Limited proteolysis to assess folding quality

    • Intrinsic fluorescence spectroscopy to monitor tertiary structure

    • Crosslinking studies to identify proximity relationships

Functional Assessment:

  • Protein-protein interaction studies:

    • Pull-down assays with other ATP synthase components

    • Surface plasmon resonance (SPR) to measure binding kinetics

    • Crosslinking coupled with mass spectrometry to map interaction interfaces

  • Reconstitution experiments:

    • Incorporation into liposomes or nanodiscs

    • Co-reconstitution with other ATP synthase components

    • Assessment of proper membrane insertion and orientation

  • Activity assays:

    • Assembly into partial or complete ATP synthase complexes

    • Proton translocation measurements in reconstituted systems

    • ATP synthesis activity when incorporated into functional complexes

A particular focus should be placed on verifying that the recombinant protein maintains the correct alpha-helical secondary structure, as this has been used as a key quality indicator for recombinant ATP synthase subunits .

How do environmental factors affect H. akashiwo ATP synthase expression and function?

Heterosigma akashiwo is known to respond significantly to environmental parameters, which likely influence the expression and function of its chloroplast proteins, including ATP synthase components:

Key Environmental Factors:

  • Temperature:

    • Temperature significantly affects H. akashiwo growth and metabolism

    • Statistical analysis has shown significant differences in H. akashiwo responses between 25°C and 15°C (p-value = 0.002)

    • ATP synthase expression and activity likely adapt to different temperature regimes

  • Salinity:

    • Salinity shows significant effects on H. akashiwo metabolism

    • Osmotic stress may require adjustments in energy production pathways

    • ATP synthase activity might be modulated to maintain energy balance under different salinity conditions

  • Light intensity:

    • As a photosynthetic organism, light regulates many chloroplast proteins

    • ATP synthase expression likely coordinates with photosynthetic activity

    • Diurnal cycles may create rhythmic patterns of expression and activity

Research Approaches:
To effectively study environmental influences on H. akashiwo ATP synthase, researchers should apply:

  • Design of Experiments (DOE) approach:

    • Use central composite design (CCD) to examine multiple factors simultaneously

    • Analyze interaction effects between temperature, salinity, and light

    • Apply response surface methodology (RSM) to model complex relationships

  • Multi-parameter measurements:

    • Transcript abundance (RT-qPCR)

    • Protein expression levels (Western blotting)

    • ATP synthase activity assays

    • Chloroplast ultrastructure analysis

This multi-parameter approach would provide more accurate insights than traditional one-factor-at-a-time methods, revealing how H. akashiwo ATP synthase responds to complex environmental changes in its natural habitat .

What techniques can be used to study the function of the chloroplast transit peptide in H. akashiwo ATP synthase subunit b?

The chloroplast transit peptide is crucial for targeting nuclear-encoded proteins to the chloroplast. For H. akashiwo ATP synthase subunit b, the following approaches can be used to analyze this important element:

Identification and Characterization:

  • Bioinformatic prediction:

    • Use specialized algorithms (ChloroP, TargetP, Predotar) to predict the transit peptide region

    • Analyze amino acid composition and physicochemical properties

    • Compare with known transit peptides from other algae

  • Experimental mapping:

    • N-terminal sequencing of mature protein to determine the cleavage site

    • Create truncation series to define the minimal functional transit peptide

    • Mass spectrometry to identify post-translational modifications

Functional Analysis:

  • GFP fusion assays:

    • Create fusion constructs with the predicted transit peptide linked to GFP

    • Transform into H. akashiwo or model algal systems

    • Use confocal microscopy to visualize chloroplast targeting

    • Compare efficiency with transit peptides from other organisms

  • In vitro import assays:

    • Isolate intact chloroplasts from H. akashiwo

    • Synthesize radiolabeled precursor proteins

    • Perform import reactions under various conditions

    • Analyze processing and localization by autoradiography

  • Mutational analysis:

    • Create site-directed mutations in key regions of the transit peptide

    • Test the effect on import efficiency

    • Identify critical residues or motifs required for targeting

Research has shown that transit peptides from secondary endosymbiotic algae have distinctive features compared to those of other algae . Similar studies with H. akashiwo would help understand how secondary endosymbiosis has shaped protein targeting mechanisms in raphidophytes.

What are the challenges in structural studies of H. akashiwo ATP synthase subunit b?

Structural characterization of H. akashiwo ATP synthase subunit b faces several technical challenges:

Membrane Protein-Specific Challenges:

  • Expression and purification difficulties:

    • Hydrophobic nature complicates expression in heterologous systems

    • Detergent requirements for extraction and purification

    • Maintaining structural integrity outside the native membrane environment

    • Protein instability during purification procedures

  • Crystallization barriers:

    • Detergent micelles complicate crystal formation

    • Limited polar surfaces for crystal contacts

    • Conformational heterogeneity

    • Dynamic nature of stator components

  • NMR limitations:

    • Size constraints for solution NMR

    • Complex isotope labeling requirements

    • Signal broadening due to detergent micelles

    • Peak overlap due to helical structure

H. akashiwo-Specific Considerations:

  • Limited prior knowledge:

    • Few studies on H. akashiwo ATP synthase compared to model organisms

    • Incomplete understanding of species-specific adaptations

    • Lack of reference structures from closely related species

  • Experimental challenges:

    • Limited molecular tools optimized for this organism

    • Specialized marine culture conditions required

    • Potential toxicity considerations during handling

Strategic Approaches:
To overcome these challenges, researchers should consider:

These approaches would help overcome the inherent difficulties in structural characterization of this challenging membrane protein.

What techniques are most effective for studying the interactions between H. akashiwo ATP synthase subunit b and other ATP synthase components?

Understanding the interactions between H. akashiwo ATP synthase subunit b and other components of the ATP synthase complex requires specialized techniques:

In Vitro Interaction Analysis:

  • Co-immunoprecipitation (Co-IP):

    • Develop antibodies specific to H. akashiwo ATP synthase subunit b

    • Use detergent-solubilized membranes to maintain native interactions

    • Identify interaction partners by mass spectrometry

    • Quantify interaction strengths under various conditions

  • Crosslinking coupled with mass spectrometry (XL-MS):

    • Apply membrane-permeable crosslinking agents to intact complexes

    • Identify crosslinked peptides by tandem mass spectrometry

    • Map interaction interfaces at amino acid resolution

    • Generate distance constraints for structural modeling

  • Surface Plasmon Resonance (SPR) or Bio-Layer Interferometry (BLI):

    • Immobilize purified subunit b onto sensor surfaces

    • Measure binding kinetics with other purified ATP synthase components

    • Determine association/dissociation constants

    • Assess effects of mutations on binding parameters

Mutagenesis Approaches:
Research on spinach chloroplast ATP synthase has demonstrated how specific residues at subunit interfaces can be conformationally coupled to functional sites over long distances (>40 Å) . Similar approaches could be applied to H. akashiwo:

  • Site-directed mutagenesis:

    • Target conserved residues at predicted interfaces

    • Create point mutations (e.g., Cys to Trp, as used in spinach ATP synthase)

    • Assess effects on complex assembly and function

    • Identify critical residues for subunit interactions

  • Domain swapping experiments:

    • Create chimeric proteins with domains from different species

    • Test complementation in model organisms

    • Identify regions responsible for specific functions

    • Map species-specific interactions

These approaches would build on findings from similar studies in other organisms, such as the investigation that identified critical interactions between alpha and beta subunits in spinach chloroplast ATP synthase .

What methods can be used to study the role of H. akashiwo ATP synthase subunit b in energy transduction?

ATP synthase subunit b plays a critical role in energy transduction, linking proton translocation to ATP synthesis. Several approaches can be used to investigate this function:

Biochemical and Biophysical Approaches:

  • Site-directed spin labeling and electron paramagnetic resonance (EPR):

    • Introduce spin labels at strategic positions in subunit b

    • Monitor conformational changes during catalysis

    • Measure distances between labeled sites

    • Track conformational dynamics during ATP synthesis

  • Fluorescence resonance energy transfer (FRET):

    • Label specific sites with fluorescent probes

    • Monitor real-time conformational changes

    • Measure distances between labeled sites

    • Analyze energy transfer during catalytic cycles

  • Reconstitution systems:

    • Incorporate purified subunit b into liposomes

    • Co-reconstitute with other ATP synthase components

    • Generate proton gradients using pH jumps or light-driven pumps

    • Measure ATP synthesis activity

Mutational Analysis:

  • Structure-guided mutagenesis:

    • Identify conserved residues likely involved in energy transduction

    • Create point mutations to disrupt specific interactions

    • Test the effect on ATP synthesis without affecting complex assembly

    • Identify residues that specifically affect energy coupling

  • Functional complementation:

    • Express H. akashiwo subunit b in model organisms lacking their native subunit

    • Test for functional complementation

    • Create hybrid complexes to study species-specific features

    • Analyze the effect of environmental parameters on complementation efficiency

The spinach chloroplast ATP synthase study provides a valuable precedent, showing how a single amino acid substitution (Cys to Trp) at a subunit interface could block ATP synthesis in vivo without significantly impairing ATPase activity in vitro . This approach revealed that "the in vivo coupling of nucleotide binding at catalytic sites to transmembrane proton movement may involve an interaction, via conformational changes, between the amino-terminal domains of the alpha and beta subunits" . Similar strategies could uncover the energy transduction mechanism involving subunit b in H. akashiwo.

How can researchers investigate the stoichiometry and organization of the H. akashiwo ATP synthase complex?

Understanding the stoichiometry and organization of the H. akashiwo ATP synthase complex is crucial for comprehending its function and species-specific adaptations:

Determination of Subunit Stoichiometry:

  • Quantitative mass spectrometry:

    • Label-free quantification of purified complexes

    • Absolute quantification using isotope-labeled standards

    • Comparison of peptide intensities across subunits

    • Statistical analysis to determine stoichiometric ratios

  • Biochemical approaches:

    • SDS-PAGE analysis with densitometry

    • Western blotting with subunit-specific antibodies

    • Chemical crosslinking to stabilize native complexes

    • Size exclusion chromatography with multi-angle light scattering (SEC-MALS)

Analysis of C-ring Stoichiometry:
The c-ring stoichiometry is particularly important as it determines the H⁺/ATP ratio, which varies across species and is organism-dependent . Methods to determine this include:

  • Atomic force microscopy:

    • Imaging of isolated c-rings

    • Direct counting of c-subunits per ring

    • Measurement of ring dimensions

    • Statistical analysis of multiple samples

  • Mass determination:

    • Mass spectrometry of intact c-rings

    • Correlation with known masses of individual c-subunits

    • Confirmation of stoichiometry by molecular mass

  • Cryo-electron microscopy:

    • Single-particle analysis of isolated complexes

    • Direct visualization of c-ring structure

    • Symmetry determination from image processing

    • 3D reconstruction to determine subunit arrangement

Research has shown that "the ratio of protons translocated to ATP synthesized varies according to the number of c-subunits (n) per oligomeric ring (cₙ) in the enzyme, which is organism dependent" . Investigating this ratio in H. akashiwo would provide insights into how this marine alga has adapted its energy conversion efficiency to its specific ecological niche.

What are the key research gaps in our understanding of H. akashiwo ATP synthase subunit b?

Despite advances in ATP synthase research, significant knowledge gaps remain regarding H. akashiwo ATP synthase subunit b and its role in the complete complex:

  • Structural characterization:

    • No high-resolution structure exists for H. akashiwo ATP synthase or its subunit b

    • The precise boundaries of the transit peptide, transmembrane domain, and functional domains remain uncharacterized

    • The stoichiometry and subunit organization in this species have not been determined

    • The mechanism of assembly into the complete complex is poorly understood

  • Functional specialization:

    • How the protein adapts to marine environments is unknown

    • The effects of environmental parameters (temperature, salinity, light) on ATP synthase function require investigation

    • The relationship between ATP synthase efficiency and H. akashiwo bloom formation or toxicity remains unexplored

    • Regulatory mechanisms controlling ATP synthase activity in this species are undetermined

  • Technical limitations:

    • Lack of optimized expression systems for H. akashiwo membrane proteins

    • Limited genetic tools for manipulating H. akashiwo

    • Challenges in culturing and experimental handling of this marine organism

Addressing these gaps requires multidisciplinary approaches combining molecular biology, structural biology, biochemistry, and ecological studies.

What future research directions would advance our understanding of H. akashiwo ATP synthase subunit b?

To advance our understanding of H. akashiwo ATP synthase subunit b, several promising research directions should be pursued:

  • Structural studies:

    • High-resolution structure determination using cryo-EM or X-ray crystallography

    • Comparative structural analysis with ATP synthases from related species

    • Investigation of environmental adaptations reflected in structural features

    • Analysis of conformational dynamics during the catalytic cycle

  • Environmental adaptation mechanisms:

    • Systematic investigation of how ATP synthase function responds to environmental parameters

    • Application of design of experiments (DOE) approaches to model complex environmental interactions

    • Study of ATP synthase regulation during bloom formation

    • Examination of adaptations to marine conditions compared to freshwater relatives

  • Technical developments:

    • Optimization of recombinant expression systems for H. akashiwo membrane proteins

    • Development of genetic manipulation tools for H. akashiwo

    • Establishment of protocols for functional reconstitution of H. akashiwo ATP synthase

    • Creation of antibodies and other specific research tools

  • Integration with toxicity studies:

    • Investigation of potential links between ATP synthase function and toxin production

    • Analysis of energy requirements during bloom formation

    • Correlation between ATP production capacity and cell toxicity

    • Examination of ATP synthase as a potential target for bloom management

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.